NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F025200

Metagenome / Metatranscriptome Family F025200

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F025200
Family Type Metagenome / Metatranscriptome
Number of Sequences 202
Average Sequence Length 88 residues
Representative Sequence LRPLHVGDDVLGHPNGVVPTPFLLPNLVSNHLAICLLFDHIGGAITFVPPVGLGVDERTLDCELLLVLLIRKLLPWLRTLVGLVAFFVAL
Number of Associated Samples 122
Number of Associated Scaffolds 202

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 56.50 %
% of genes near scaffold ends (potentially truncated) 55.45 %
% of genes from short scaffolds (< 2000 bps) 96.04 %
Associated GOLD sequencing projects 122
AlphaFold2 3D model prediction Yes
3D model pTM-score0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (95.050 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(79.208 % of family members)
Environment Ontology (ENVO) Unclassified
(94.554 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(57.426 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 51.69%    β-sheet: 0.00%    Coil/Unstructured: 48.31%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 202 Family Scaffolds
PF14223Retrotran_gag_2 1.49
PF03732Retrotrans_gag 0.50
PF00931NB-ARC 0.50


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.05 %
UnclassifiedrootN/A4.95 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005841|Ga0068863_100949140All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum861Open in IMG/M
3300005843|Ga0068860_100796158All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum958Open in IMG/M
3300009553|Ga0105249_11143695All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum849Open in IMG/M
3300009980|Ga0105135_105532All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum841Open in IMG/M
3300009980|Ga0105135_113318All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum660Open in IMG/M
3300009981|Ga0105133_104729Not Available860Open in IMG/M
3300009990|Ga0105132_113014All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum735Open in IMG/M
3300009992|Ga0105120_1005306All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1114Open in IMG/M
3300009994|Ga0105126_1022911All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum692Open in IMG/M
3300009995|Ga0105139_1060262All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae686Open in IMG/M
3300009995|Ga0105139_1094847All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum571Open in IMG/M
3300010371|Ga0134125_11273384All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum803Open in IMG/M
3300010371|Ga0134125_12344874All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum580Open in IMG/M
3300010397|Ga0134124_12467955All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum562Open in IMG/M
3300010403|Ga0134123_11496405All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum719Open in IMG/M
3300014968|Ga0157379_10860968All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum858Open in IMG/M
3300015278|Ga0182099_1014350All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum785Open in IMG/M
3300015280|Ga0182100_1044812All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum662Open in IMG/M
3300015280|Ga0182100_1096613All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum507Open in IMG/M
3300015284|Ga0182101_1024838All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum791Open in IMG/M
3300015284|Ga0182101_1080222All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum544Open in IMG/M
3300015290|Ga0182105_1063595All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum608Open in IMG/M
3300015290|Ga0182105_1103454All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum510Open in IMG/M
3300015297|Ga0182104_1047292All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae698Open in IMG/M
3300015297|Ga0182104_1053897All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae669Open in IMG/M
3300015301|Ga0182184_1033796All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum727Open in IMG/M
3300015301|Ga0182184_1077677All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum552Open in IMG/M
3300015306|Ga0182180_1084071All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum525Open in IMG/M
3300015309|Ga0182098_1088125All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum576Open in IMG/M
3300015310|Ga0182162_1030456All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum835Open in IMG/M
3300015310|Ga0182162_1061521All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum662Open in IMG/M
3300015312|Ga0182168_1086184All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum604Open in IMG/M
3300015313|Ga0182164_1013689All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1105Open in IMG/M
3300015316|Ga0182121_1007640All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1377Open in IMG/M
3300015316|Ga0182121_1050266All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum763Open in IMG/M
3300015317|Ga0182136_1071838All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum651Open in IMG/M
3300015317|Ga0182136_1102580All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum570Open in IMG/M
3300015317|Ga0182136_1107537All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum560Open in IMG/M
3300015320|Ga0182165_1098829All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum590Open in IMG/M
3300015325|Ga0182148_1093553All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum598Open in IMG/M
3300015327|Ga0182114_1014836All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1177Open in IMG/M
3300015327|Ga0182114_1033786All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum911Open in IMG/M
3300015327|Ga0182114_1113217All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum585Open in IMG/M
3300015328|Ga0182153_1027948All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum921Open in IMG/M
3300015329|Ga0182135_1066160All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum698Open in IMG/M
3300015329|Ga0182135_1122698All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum553Open in IMG/M
3300015332|Ga0182117_1150072All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum531Open in IMG/M
3300015332|Ga0182117_1163541All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum511Open in IMG/M
3300015333|Ga0182147_1157081All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum519Open in IMG/M
3300015334|Ga0182132_1110878All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum602Open in IMG/M
3300015334|Ga0182132_1116400All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum590Open in IMG/M
3300015334|Ga0182132_1122198All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum578Open in IMG/M
3300015335|Ga0182116_1160660All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum529Open in IMG/M
3300015336|Ga0182150_1066501All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum719Open in IMG/M
3300015336|Ga0182150_1162608All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum507Open in IMG/M
3300015337|Ga0182151_1138756All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae542Open in IMG/M
3300015337|Ga0182151_1143112All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum536Open in IMG/M
3300015337|Ga0182151_1163595All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum506Open in IMG/M
3300015338|Ga0182137_1110516All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum621Open in IMG/M
3300015348|Ga0182115_1166499Not Available707Open in IMG/M
3300015348|Ga0182115_1218224All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum610Open in IMG/M
3300015348|Ga0182115_1231854All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum589Open in IMG/M
3300015348|Ga0182115_1244260All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum572Open in IMG/M
3300015348|Ga0182115_1260209All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum551Open in IMG/M
3300015348|Ga0182115_1293153All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum514Open in IMG/M
3300015349|Ga0182185_1227002All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum567Open in IMG/M
3300015349|Ga0182185_1238384Not Available553Open in IMG/M
3300015349|Ga0182185_1267684All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum521Open in IMG/M
3300015349|Ga0182185_1273554All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum515Open in IMG/M
3300015353|Ga0182179_1160199Not Available705Open in IMG/M
3300015353|Ga0182179_1228924All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum596Open in IMG/M
3300015353|Ga0182179_1253008Not Available568Open in IMG/M
3300015354|Ga0182167_1216830All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum697Open in IMG/M
3300017414|Ga0182195_1113546All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum659Open in IMG/M
3300017414|Ga0182195_1147073All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum595Open in IMG/M
3300017414|Ga0182195_1190057All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum536Open in IMG/M
3300017422|Ga0182201_1038534All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum785Open in IMG/M
3300017422|Ga0182201_1045366All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum745Open in IMG/M
3300017422|Ga0182201_1054861All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum701Open in IMG/M
3300017422|Ga0182201_1102034All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum569Open in IMG/M
3300017432|Ga0182196_1037152All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum820Open in IMG/M
3300017432|Ga0182196_1045621All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae767Open in IMG/M
3300017432|Ga0182196_1053748All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum726Open in IMG/M
3300017432|Ga0182196_1056299All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum715Open in IMG/M
3300017435|Ga0182194_1083633All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum633Open in IMG/M
3300017435|Ga0182194_1145429All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum515Open in IMG/M
3300017439|Ga0182200_1121968All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum559Open in IMG/M
3300017440|Ga0182214_1159013All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum504Open in IMG/M
3300017445|Ga0182198_1073972All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum738Open in IMG/M
3300017445|Ga0182198_1096747All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum670Open in IMG/M
3300017445|Ga0182198_1131853All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum596Open in IMG/M
3300017445|Ga0182198_1189083All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum517Open in IMG/M
3300017445|Ga0182198_1192865All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae513Open in IMG/M
3300017445|Ga0182198_1202969All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum502Open in IMG/M
3300017692|Ga0182210_1096754All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum634Open in IMG/M
3300017693|Ga0182216_1104072All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum683Open in IMG/M
3300017693|Ga0182216_1114023All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum659Open in IMG/M
3300017694|Ga0182211_1117101All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum627Open in IMG/M
3300020031|Ga0182119_105121All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum563Open in IMG/M
3300022465|Ga0213505_120505All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum529Open in IMG/M
3300022466|Ga0213504_105530All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum532Open in IMG/M
3300025290|Ga0207673_1038622All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum668Open in IMG/M
3300025925|Ga0207650_10518440All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum997Open in IMG/M
3300025936|Ga0207670_11279789All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum622Open in IMG/M
3300025941|Ga0207711_11942694All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum531Open in IMG/M
3300028050|Ga0268328_1068798All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum511Open in IMG/M
3300028054|Ga0268306_1020580All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum600Open in IMG/M
3300028055|Ga0268338_1006283All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum897Open in IMG/M
3300028055|Ga0268338_1043411All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum508Open in IMG/M
3300028058|Ga0268332_1079835All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum501Open in IMG/M
3300028064|Ga0268340_1017888All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum861Open in IMG/M
3300028142|Ga0268347_1018415All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum613Open in IMG/M
3300028143|Ga0268348_1013364All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum620Open in IMG/M
3300028148|Ga0268354_1016827All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum597Open in IMG/M
3300028248|Ga0268312_1038967All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum500Open in IMG/M
3300028253|Ga0268316_1008791All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum688Open in IMG/M
3300028253|Ga0268316_1012524All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum621Open in IMG/M
3300028253|Ga0268316_1019449All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum544Open in IMG/M
3300028253|Ga0268316_1023660All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum512Open in IMG/M
3300028262|Ga0268310_1049428All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum513Open in IMG/M
3300028464|Ga0268302_101936All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum836Open in IMG/M
3300028471|Ga0268323_1002677All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum910Open in IMG/M
3300028472|Ga0268315_1015596All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum603Open in IMG/M
3300028475|Ga0268327_1020111All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum554Open in IMG/M
3300028525|Ga0268305_109450All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum547Open in IMG/M
3300028525|Ga0268305_110319All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum532Open in IMG/M
3300032464|Ga0214492_1077691All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum633Open in IMG/M
3300032465|Ga0214493_1000054All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum6996Open in IMG/M
3300032465|Ga0214493_1089487All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum733Open in IMG/M
3300032465|Ga0214493_1164151All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum510Open in IMG/M
3300032466|Ga0214503_1189386All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae641Open in IMG/M
3300032467|Ga0214488_1000118All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum5449Open in IMG/M
3300032467|Ga0214488_1058725All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum852Open in IMG/M
3300032467|Ga0214488_1118944Not Available562Open in IMG/M
3300032468|Ga0214482_1006511All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1798Open in IMG/M
3300032469|Ga0214491_1000914All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum3921Open in IMG/M
3300032469|Ga0214491_1078786All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum796Open in IMG/M
3300032469|Ga0214491_1129736All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum596Open in IMG/M
3300032490|Ga0214495_1009605All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1876Open in IMG/M
3300032514|Ga0214502_1002536All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum4192Open in IMG/M
3300032514|Ga0214502_1357338All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum551Open in IMG/M
3300032548|Ga0214483_1053721All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum677Open in IMG/M
3300032548|Ga0214483_1067606All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum592Open in IMG/M
3300032550|Ga0321340_1021428All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum911Open in IMG/M
3300032550|Ga0321340_1059456Not Available523Open in IMG/M
3300032551|Ga0321339_1000390All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum3966Open in IMG/M
3300032551|Ga0321339_1007383All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1921Open in IMG/M
3300032551|Ga0321339_1064327All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum843Open in IMG/M
3300032551|Ga0321339_1111556All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum618Open in IMG/M
3300032589|Ga0214500_1090743All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum865Open in IMG/M
3300032589|Ga0214500_1172346All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum615Open in IMG/M
3300032590|Ga0214489_1033865All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae767Open in IMG/M
3300032590|Ga0214489_1063766All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum545Open in IMG/M
3300032591|Ga0214484_1099716Not Available598Open in IMG/M
3300032593|Ga0321338_1327800All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum548Open in IMG/M
3300032625|Ga0214501_1130014All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum804Open in IMG/M
3300032689|Ga0214497_1079126All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum724Open in IMG/M
3300032697|Ga0214499_1046843All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1262Open in IMG/M
3300032697|Ga0214499_1071109All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1047Open in IMG/M
3300032698|Ga0214485_1057392All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum748Open in IMG/M
3300032699|Ga0214494_1049977All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum805Open in IMG/M
3300032699|Ga0214494_1055571All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum761Open in IMG/M
3300032699|Ga0214494_1091288All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum573Open in IMG/M
3300032761|Ga0314733_1077245All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum634Open in IMG/M
3300032781|Ga0314742_1039613All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum839Open in IMG/M
3300032781|Ga0314742_1062584All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum647Open in IMG/M
3300032789|Ga0314725_1006203All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1366Open in IMG/M
3300032791|Ga0314748_1058393All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum822Open in IMG/M
3300032792|Ga0314744_1008874All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1714Open in IMG/M
3300032811|Ga0314718_1024289All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum734Open in IMG/M
3300032822|Ga0314740_1007483All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1457Open in IMG/M
3300032823|Ga0314723_1089318All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum577Open in IMG/M
3300032823|Ga0314723_1102894All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum529Open in IMG/M
3300032824|Ga0314735_1000687All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum3297Open in IMG/M
3300032824|Ga0314735_1102552All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum528Open in IMG/M
3300032844|Ga0314743_1044766All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1032Open in IMG/M
3300032844|Ga0314743_1107400All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum637Open in IMG/M
3300032845|Ga0314727_1059812All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum506Open in IMG/M
3300032875|Ga0314737_1013821All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1293Open in IMG/M
3300032875|Ga0314737_1058830All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum662Open in IMG/M
3300032913|Ga0314739_1020945All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1192Open in IMG/M
3300032913|Ga0314739_1027580All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1056Open in IMG/M
3300032915|Ga0314749_1099000All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum627Open in IMG/M
3300032915|Ga0314749_1099234All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum626Open in IMG/M
3300032917|Ga0314721_121396All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum687Open in IMG/M
3300032918|Ga0314726_116071All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum847Open in IMG/M
3300032934|Ga0314741_1071831All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae805Open in IMG/M
3300032953|Ga0314729_117282All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum568Open in IMG/M
3300032970|Ga0314716_143199All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum508Open in IMG/M
3300033523|Ga0314768_1143123All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum840Open in IMG/M
3300033525|Ga0314758_1164709All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum605Open in IMG/M
3300033526|Ga0314761_1133177All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum548Open in IMG/M
3300033530|Ga0314760_1014274All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1760Open in IMG/M
3300033531|Ga0314756_1044549All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum785Open in IMG/M
3300033533|Ga0314770_1180771All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae662Open in IMG/M
3300033533|Ga0314770_1206895All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum615Open in IMG/M
3300033539|Ga0314762_1071246All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum650Open in IMG/M
3300033542|Ga0314769_1029271All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1608Open in IMG/M
3300033542|Ga0314769_1143180All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum798Open in IMG/M
3300033542|Ga0314769_1193981All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum681Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere79.21%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere10.89%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated3.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.99%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.50%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.50%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009980Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009990Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaGHost-AssociatedOpen in IMG/M
3300009992Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015278Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015316Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015325Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015332Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015335Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015336Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017422Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017435Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017440Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017445Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017692Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017693Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017694Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300020031Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_31MAY2016_LD2 MGHost-AssociatedOpen in IMG/M
3300022465Metatranscriptome of phyllosphere microbial comminities from switchgrass, Michigan, USA - G5R1_MAIN_12JUL2016_LR1 MT pilot (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300022466Metatranscriptome of phyllosphere microbial comminities from switchgrass, Michigan, USA - G5R1_MAIN_12SEP2016_LR1 MT pilot (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300025290Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028050Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028054Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028055Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028058Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028064Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028142Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028143Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028148Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028248Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028253Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028262Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028464Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028471Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028472Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028475Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028525Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300032464Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032465Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032466Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032467Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032468Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032469Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032490Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032514Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032548Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032550Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032551Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032589Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032590Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032591Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032593Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032625Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032689Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032697Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032698Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032699Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032761Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032781Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032789Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032791Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032792Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032811Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032822Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032823Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032824Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032844Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032845Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032875Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032913Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032915Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032917Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032918Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032934Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032953Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032970Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_15MAY2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033523Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033525Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033526Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033530Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033531Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033533Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033539Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033542Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0068863_10094914013300005841Switchgrass RhizosphereLRPLHIDDDILGHPNGAVPTPFLLPNLVSNHLAICFLLDHIGGAIAFVPPVGLGVDERTFDCKLLLVLLIRKLLPWLRTLVGLV
Ga0068860_10079615823300005843Switchgrass RhizosphereLRPLHVGDDVLGHPNGVVPTPFLLPNLVSNHLAICLLFDHIGGAITFVPPVGLGVDERTLDCELLLVLLIRKLLPWLRTLVGLVAFFVAL*
Ga0105249_1114369513300009553Switchgrass RhizosphereLWALRVGDDFLGHPNGAVPAPILLPNLLSNHFAIVLLLYHIGGVFALVLPVGLGVDERTFDCKFLLVLLIRKLFPWLRTLVGLVAFFVALR
Ga0105135_10553213300009980Switchgrass AssociatedMPLHIGDDILGPLNGVIPTPFLLPNLVSNHLAICLLFDHIGGAMAFVPPVGLGVDERTLVCELLLVLLIRKLLFWLRAFVGLVAFVMAL*
Ga0105135_11331813300009980Switchgrass AssociatedIGDDIIRHPNGVIPTSFLLPNLVSNHLAICSLLDHIGGAIALVPLVGLGVDERTLNCKLLLVFLIRKLLPWLRALVGLVAFFVAL*
Ga0105133_10472913300009981Switchgrass AssociatedVILTPFLLPNLVSNHLAIGFLLDHVGGAIALVPPVGLGLDERTLDCEFLFVLLIRELLPWLRTLVGLVAFFMAL*
Ga0105132_11301413300009990Switchgrass AssociatedLRPLHIGDDILRHQNVVIPTSFLLPNIVSNHLTICLLFDHIGGAMALVPPVGLGVDERTLNSKLLLVLLIRKLLPWLRTLVGLVAFFMAL*
Ga0105120_100530613300009992Switchgrass AssociatedLRSLHVVDDFLGHPNGAVPIPILLPNLVGNHLTIALLLDHMSGALALVLLVGLDIDERTLDGGIFLVLLIQKLLLGLRALV*
Ga0105126_102291113300009994Switchgrass AssociatedLRPLYIGDDILGHPNGVIPTPFLLPNLVSNHLTICLFDHIGDAIAFVPPVGLGVDERTLDCEFVLVLLIRKFLPWLRTHVGLVAFFVAL*
Ga0105139_106026213300009995Switchgrass AssociatedLIPLHIGDDFLGHPNRAVPTSFLLSNLVSNHLATDLLFYHIGGAIAFVPPVRLGVDERTLDCELLLILLIRKLLSW*
Ga0105139_109484713300009995Switchgrass AssociatedLRPLHISDDVLGHPNGVVPTPFILPNLVSNHLAIGLLFYYIGGAIAFVPPVGLGVDERTLDYELLLVLLIRKLLPWLRTLVGLVAFFVAL*
Ga0134125_1127338413300010371Terrestrial SoilLEPTPFEALHVGDDILGHPNGVIPTPFLLPNLMSNHLAIGFLLDHIGGAIAFGPPVGLGVDEKTLDCELFLVLLIRKLLP*
Ga0134125_1234487423300010371Terrestrial SoilHVDDDVLGHSNGVVPTPFVLPNLMSNHLVIGLLFYHIGGAIAFVSPVGLGVYERTLDCEFLVVLLIRKFLPWLRALV*
Ga0134124_1246795513300010397Terrestrial SoilLRPLHVGYDILGHPNGVIPTPFLLPNLVSNHLAIGFLLDHIGAAMALVPLVGPGVDERTLDCKLILALLIRKLLPWLRTLVGLVAFFVAL*
Ga0134123_1149640513300010403Terrestrial SoilLRPLHIGDDVLGHPNGVVPTPFFLPNLVSNHLVICFLFDHIGGVIAFVPPVGLGVDERTLDCELLFVLLIRKLLPWLRILVGLVAFFMAFETSH
Ga0157379_1086096813300014968Switchgrass RhizosphereMIPTPFLLSNLVSNHLAIGFLFDHIGGAITFVPPVGLGVDERTLDCELFLILLIRKVLLWLNILVGLVAFFMAL*
Ga0182099_101435013300015278Switchgrass PhyllosphereLRPLYIDDDILGHPNGVIPTTFLLPNLVRNHLAVCFLLDHIGGAMTLVPTVGLGVDERTLDCEFLLVLLIRNLLSWLRTLVGLVAFMMALARR
Ga0182100_104481213300015280Switchgrass PhyllosphereLRPLHVGVDFLGHPIRAVPTPFLLPNLVSNHLPIDLLVDHIGGAFAFVLAIGLGVDERTLDCELLLVLLIRKLLSWLRILVGLVASFVALRASHGAPLLKLLHHV
Ga0182100_109661313300015280Switchgrass PhyllosphereNGVIPTPSLLPNLASNHLAIGFLLDNIGSAMTLVPLVGLGVDEKILDCEFLLVLLIQKFLPWLRTFVGLVASLMAL*
Ga0182101_102483813300015284Switchgrass PhyllosphereLRPLHVGDDVLGHPNGVVPTPFLLPNLVSNHLAIGLLFDHIGGAIAFVPPVGLGVDERTLDCKLLLVLLIRKFLLWLRALVGLVTYLMAF*
Ga0182101_108022223300015284Switchgrass PhyllosphereVIPTTFLLPNLVSNHLAIGFLLDHIGGAIALVPPVRLGVDERTLDSEFFFVLLIRKLLPWLRTLVGLVAFMMAL*
Ga0182105_106359513300015290Switchgrass PhyllosphereLRPLHIGDDVLVHPNGVVPTPFLLPNLVSNHLAIGLLFDHIGGAIAFVPPVGLGVDERTLDCELSLILLIRKLL
Ga0182105_110345413300015290Switchgrass PhyllosphereALSLLWNPHHLKPLHIGDDILGHPNRVISTPFLLPNNVSNLLAIGLLFYHIGGIIAFVPPDGLGVDEKTLDCELLLVLLILKLLPWWRTLVELVAFFVAL*
Ga0182104_104729213300015297Switchgrass PhyllosphereVIPTPFLLPNLVSNHLAIGFLLDHIGDAIALVPPVGLGVDERTLDSEFLFVLLIRKLLLLLRTLVGLVAFMMAF*
Ga0182104_105389713300015297Switchgrass PhyllosphereRPLHIGDDFFGHSKGVIPTPFLLPNLVSNHIAICHLFDHIGGAMALIPSVGLGVNERTLDCKLLFVLLIRKLLLWLRELVGLVAFLMAFRESHGGPLLKLLHHASRLS*
Ga0182184_103379623300015301Switchgrass PhyllosphereVIPTPFLLPNLVSNHLAICLLFYHIGGAIAFVPPIGLGVDERTLDCEFLLVLLIRKLLPWLRTLVGLVAFFVAL*
Ga0182184_107767713300015301Switchgrass PhyllosphereVIPTPFLLPKLVSNHLAIGFLLDHVGGAIVFVPPVGLGVDERTLDYEFLFILLIRKLLPWLRTLVGLVAFFVAL*
Ga0182180_108407113300015306Switchgrass PhyllosphereKLIIQIPRNHSWASSLLWNPHHLRPLYISDDVFRHPNGAVPTPILLPNLVSNHFAIFLLLDHIGGAFALVLLVGLGVDEITLDCEFLFVLLIRKLLLWLRTLVGLVAFMMAL*
Ga0182098_108812513300015309Switchgrass PhyllosphereVIPTPFLLPNLVSNHLTIGFLLDHIGGAIAFIPPVGLGLDERTLNCEFLLVLLIRKLLHWLRAHVGLVAFFIAL*
Ga0182162_103045613300015310Switchgrass PhyllosphereLQIPRSHSWASSLLWNPHHLRPFHFGDDILRHPNGVIPTPFLLPNLVSNHLAICLLFDHIGGSIALVSPVGLGIDERTLDFEFLFVLLTRKLFPWLRTLVGLVAFVMAL*
Ga0182162_106152113300015310Switchgrass PhyllosphereLRPLQVGDDVPGHPNGVVPTPFLLPNFVSNHLAICILFYYIGGAIAFVPPVGLGVDERTLDCELLFVLLIRKLLPWLRTLVGLVTFFVAL*
Ga0182168_108618413300015312Switchgrass PhyllosphereLRPLHIGDDILGHPNGVIPTPFLLSNFVSNHLAICLLFDHIGGAMALVPPVGLGVDERTLDCKLHLILLIRKLLLWLRTLVGLVAFMMALSASHGGP
Ga0182164_101368913300015313Switchgrass PhyllosphereLRPLHIGDDFLGHPNGTVPTSFLLPNLVSNHLAIGLLFYHIGGAIVFVPPVGLGVDERTLDCEFLLVLLIRELLLWLRSLVRLVAIVMPLEACNGGPLLKLLH
Ga0182121_100764023300015316Switchgrass PhyllosphereLGFKYPLEPTPFEALHIGDDILGHPNGVIPTPFRLPNLVSNHLAIGLFLDHIGGAIAFVPPVGLGVDERTLDCELLLVLIIRKFPLWLRALCKKNMDLK*
Ga0182121_105026613300015316Switchgrass PhyllosphereLRPLHVGDDFFGHPNGAVSTPILLPNLVSNHFAIGLLFDYIGGAIAFVPPVGLGVDERTLDCELLLVLLSRKLLPWLR
Ga0182136_107183813300015317Switchgrass PhyllosphereIDDDILGHPNGVISTPFLLPNLMSNHLAICLLFDHIGCAMALVPSVGLGVNERTLDCKLLFVLLIRKLLLWLRELVGLVAFLMAFRESHGGPLLKLLHHASRLS*
Ga0182136_110258023300015317Switchgrass PhyllosphereSFGHPNGVIPTPFLLPNFMSNHLAIGFLLDHIGGAIAFVPPVGLGVDERTLDCKFLLVLLIRKFLPWLGHLLDLWPLWWHLEQVTVDSFSSFFTMSSRLS*
Ga0182136_110753723300015317Switchgrass PhyllosphereLRPLYIGDDILGHQNGVIPTPFLLPNLVSNHLAIGLLLDHIGGAIVFVPPVGLGVDERTFDCELLLVLLIRKLLLWLRAHVGLVAFFIAL*
Ga0182165_109882913300015320Switchgrass PhyllosphereVIPTPFLLPNLVSNHLAIGFLLDHIGGAIALVPPVGLGVDERTLDCEFLFVLLIRKLLLWLRTLVGLVAFMMAL*
Ga0182148_109355323300015325Switchgrass PhyllosphereLHVGDDVLGHPNGVVPTPFLLPNLVSNHLAIGLLFYHIGGAIDFVPPVGLGVDERTLNCEFFLVLLIRKLLSWLRTLVGLVVFFVAL*
Ga0182114_101483613300015327Switchgrass PhyllosphereLEPTPFEALHIGDDILGHPNGVIRTPFRLPNLVSNNLAICILFDYIGSAIAFVPLVGLGVDERTLDCELLLVLIIRKFPLWLRALCKKNMDLK*
Ga0182114_103378623300015327Switchgrass PhyllosphereLRPLHVGDDFLGHPNGAVPTPFLLPNLVSNHLAIALLLDYIGGAIAFVSLVGLGVDERTLDSDLLLVLLIRKLVPIL*
Ga0182114_111321713300015327Switchgrass PhyllosphereVIPTPLLLPNLVSNHLAIGFLLDHIGGAIALVPPVGLGVDERTLDCEFLLVFFIRKLLPSLRILVGLVAFMMAL*
Ga0182153_102794823300015328Switchgrass PhyllosphereLWNPYHLMPLHIGDDILGHLNGVIPTPFMLPNLVSNYLAIGFLLDHICGAFALVLLVGLGVDERTLDCDFLLVLLIWKLLLWLKHLLDL*
Ga0182135_106616013300015329Switchgrass PhyllospherePHHLRPLDIGDAILGYPNGVIPTTFLLPNLVSNHLAIGLLFDHIGGAIAFVPPFGLSVDERTLDCELLFVLLIRKLLLWLRAFVGLVAFFMTL*
Ga0182135_112269823300015329Switchgrass PhyllosphereHIGDDFFGHPKGVIPTPFLLPNLVSNHIAICHLFDHIGGAMALVPSVGLGVNERTLDCKLLFVLLIRKLLLWLRELVGLVAFLMAFRESHGGPLLKLLHHASRLS*
Ga0182117_115007223300015332Switchgrass PhyllosphereVGDDFLGHPNGAVPTPILLPNFVSNHLAIVLLLDHIGGAFALVLPVGLGVDERTLDCDFLFILLIRKLLLWLRAPVGLVAFLMAL*
Ga0182117_116354113300015332Switchgrass PhyllosphereLRSLHVGDDFLGHPNGAVPTPIFLPNLVSNHFAIVLLLDYIGGAFALVLLVELGVDERTLDCDLLLVLLISVFSLRLDISTV
Ga0182147_112422813300015333Switchgrass PhyllosphereQLLFPNLVSNHLAICFLLDHIGDAIALVPPVGLGVDERTLDCEFLLWLRALVGLVAFMVAL*
Ga0182147_115708113300015333Switchgrass PhyllosphereIDDHILGHPNEAVPTLFLLPNLVSNHLAICFLFYYIGDAIALVPPVGFGVDERTLDCELLLVLLIRKVLLWLRAFVGLVAFVMAL*
Ga0182132_111087813300015334Switchgrass PhyllosphereLRLLHVGDEFLGHPNGAVPTPILLPNLVSNHLAIVLLLDHICGVFTLVLPVGLGVAERTLDSDLLLVLLIRKLVPIL*
Ga0182132_111640013300015334Switchgrass PhyllosphereLRPLHIDDDILGHPNRTVPTPFLLPNLVSNQLAIGLLFDHIGGAIAFVPPVGLSVDERTLDCKLLLVLLIRKLISWLRTLVRLVAFFVSL*
Ga0182132_112219833300015334Switchgrass PhyllosphereWASSLLWNPHHLRPLHIGDDILGHPNGVISTPFLLPNLVSKHLAIYLLLDHIGGAIALVPLIGLGVDERTLDCNFILVLLIRKLLLWLRALV*
Ga0182116_116066013300015335Switchgrass PhyllosphereISDDVLGHPNGVVPTSFLLPNLVSNHLAIGLLFNHIGGAIAFVPPVGLGVDEKTLDCEFLLVLLIWKLLPWLKILVGLVAFFVTL*
Ga0182150_106650123300015336Switchgrass PhyllosphereWASSLLWNPHHLRPLHIGYDIFGHPNGVIPTPFLLPNLVSNHIAIGFLHDHIGGAIAFVSPVGLGVDERTLDCYPLLVLLIRNLLWLRALVGVVAFLWHFEKVTVDPFSSFFTMSSRLS*
Ga0182150_116260813300015336Switchgrass PhyllospherePTPSLLPNLVSNHLAIGFLLDHIGSAMTLVPLVGLDVDERTLDCEFLLVLLIWKLLLRLRTLVGLVVFFVALEQVTVDPSSTFFTMSSRLS*
Ga0182151_113875613300015337Switchgrass PhyllosphereLRPLHVGDDVLGHPNGVVPTPFLLPNLVSNHLAIGLLFYHIGGAIAFVPLIRKVLPWLRTLVGLVALFVAL*
Ga0182151_114311213300015337Switchgrass PhyllosphereLRHLHIGDDILGHPNGVIPTPFLLSNLVSNHLAICFLLDNIGGAMTLVPPVGLGVDERTLDCEFLFVFLIRKLLPWLRTLVGLVAFMMAL*
Ga0182151_116359513300015337Switchgrass PhyllosphereLRPLHIGDDILGYPNGVIPTPFLLPNFVRNHLAIGFLLDHIGGAIALVPSVGLGVEERTLDCEFLLVLLIQKLLPWLRTLVGLVAFMMAL*
Ga0182137_111051613300015338Switchgrass PhyllosphereLRSLHVGDDFLGHPNGVVPTPIFLPNLVRNHFAIVLLLDYIGGAFALVLPVELGVDERTLDCDLLLVLLIRKLLLLSRALVGLVDFLM
Ga0182115_116649913300015348Switchgrass PhyllosphereLRPLHVGDDILGYPNGVVSTLFLLPNIMSNHLAIGFLFYHIGGAIAFVPPVGLGVDERTLDCELLFVLLIRKLLPWLRALVGLVAFFAALGASHGGQLLKLLHHVFTVI
Ga0182115_121822413300015348Switchgrass PhyllosphereMPLHVGDDFLGHPNGAVSTPFFLTNLVSNHLAIALLLEHICRAFAFILPVGLGVDKKTLDGEFFLVLLIRKLLLGLRALVGLVAFSMALEACHG
Ga0182115_123185413300015348Switchgrass PhyllosphereNGVVPTPFLLPNLVSNHLAIGLLFYHIGGAIAFIPPVGLDVDERTLDFDCEFLLVLLIRNLLPWLRTLVGLVAFFVAL*
Ga0182115_124426013300015348Switchgrass PhyllosphereLRPLHVGDDILGHPNGVVPTPFLLPNLVSNHLAIGLLFDHIGGAIAFVPPVGLGVDERTLDCELLLVLLIRKLLPWLRALVGLVTFFAAL*
Ga0182115_126020923300015348Switchgrass PhyllosphereHPYGVIPTSSLLPNLVSNHLAVGFLLHYIGGAITFVPLIGLGVDERTLDCKLLLVLLIRKLLLWLRAHVGLVPFTVAL*
Ga0182115_129315323300015348Switchgrass PhyllosphereLRPLHVGDDILGHPNGVVPTPFLLPNLVSNHLAICFLFDHIGGAIAFVPPVGLGVDERTLDCEFLLVLLIWKLLLRLRTLVGLVVFFVALEQVTVDPSSRFFTMSSRLS*
Ga0182185_122700213300015349Switchgrass PhyllosphereLRPLHVGDDVLGHPNEVVPTNFLLPNLASNHLSICLLFYYIGGAIVFVLPVGLGIVERTLNCELLLVLLIRKFLPW
Ga0182185_123838413300015349Switchgrass PhyllosphereVISTPFLLPNIVSNHLAIDFLFDHIGGAISFVPPVGLGVDEKTLDCELLHVLLIRKLLLWLRTLVGLAAFLWHLEQVTVDPFSSFFTMSSRLSWEGWTL
Ga0182185_126768413300015349Switchgrass PhyllosphereLRPFHIGDEFLGHPNTVAPTPFLLPNLVSNHLAICFLLDNIGGAIALVPPVGLGLDERILDCEFLFVLLIRKL
Ga0182185_127355423300015349Switchgrass PhyllospherePHHLRPLHIGDDILGHPNGVIPTPFLLSNLVSNHLAINFLLGHIGGAVVFVPPVGLGVDERTLDCEFLLVLLIRKLFLWLRTLVGLVAFLMAF*
Ga0182179_116019913300015353Switchgrass PhyllosphereLRPLHVGDDFLGHPNGAASTPNLLPNLVSNHLTTAFLLDGIGGDFAFVLLIELFVDERTLDGEILLVLLIRNLLLGSRALLGLV
Ga0182179_122892413300015353Switchgrass PhyllosphereLRPLQVGDDVLGQPNGVVSTPFLLPNLVSNHLAIGLLFDHIGGVIAFVPPVGLDVDERTLDCEFLLVLLIRKLLPWLRTLVGLVAFFVAL*
Ga0182179_125300813300015353Switchgrass PhyllosphereLGHPNGVISILFMLPNLVSNHLDIGLLLDHIGGAIIFVPPVGLGVDERTLDCELLLVLLIGRLLLRLRTLVGLVAFFMALRASHGGPTILQLSASV*
Ga0182167_121683023300015354Switchgrass PhyllosphereSTPFLLPNLVSNHLTIGLLFDQIGGAIAFVPPVGFGVDERTLDCDFLFVPLIRKLLPWLRILVRLVVFFVAL*
Ga0182195_111354613300017414Switchgrass PhyllosphereLRPLYIRDDILGHPNRVIPTPFLLPNLVSNHLAIGFLFDYVGGAIALVPSVGLGVDERTVDCEFLFVLLIRKLLSWLRTLLFFIFQSM
Ga0182195_114707313300017414Switchgrass PhyllosphereVIPTSFLLPNLVSNHLAIDLLLDHIRGAIAFVPPVGLGVDERTLDCKFLLVLLIRKLFLWLRTLVGLVAFMMAL
Ga0182195_119005713300017414Switchgrass PhyllosphereLRPLHISDDILGHPNRVAPTPFLLPKLMSNHLAIGLLFYHIEGAIAFVPPVRLGVDERTLDYELLLALLIRKLLSWLRTLVGLVT
Ga0182201_103853413300017422Switchgrass PhyllosphereLRPLHVGDDFLGHPNGAVPTPILLPILVSNHFAIVLLLDHIGGAFALVLPIGLGVDERTLNCDLLFVLLIRKHLFWLRALVGLVAFLMAL
Ga0182201_104536613300017422Switchgrass PhyllosphereLRPLHVGDDVLGHPNGVVPTPFLLPNLVSNHLAIGLLFDHIAGAIAFVPPVGLGVDERTLDCEFFLVLLIRKLLLCLRALVGLVAFFMAL
Ga0182201_105486113300017422Switchgrass PhyllosphereLSPLQVGDDVLGHPNGVVPTPLILPNLVSNHLAIGFLFDHIGGVIAFVPPVGLDVDERTLDCEFLLVLLIRKLLPWLRTLVGL
Ga0182201_110203413300017422Switchgrass PhyllosphereLVSLLDSCHHLCEPSLQILRSRFWASSLLWNPHHLRPLHISDDIPGHPNGVIPTLFLLPNLVSNHLAIDFLLDHIGDAIAFVPPVGLGVDERTFNCELLLVLIIRKLLPWLRTLVGLV
Ga0182196_103715223300017432Switchgrass PhyllosphereMLVMIFLDTQMERFELLFPNLVSSHLAIGFLLDHIGGAIAFVPPVGLGVDERTLDCELLLVLLIRKLLPWLRTLVGLVAFFVAL
Ga0182196_104562113300017432Switchgrass PhyllosphereLRSLYIDDDILGHPNRVIPTPFLLPNLVSNHLSIFLLFNQIRGVMVLVPPVGLGVDERTLDSKFLLVLLIRKFFSWLRAFVGLMASLVAL
Ga0182196_105374813300017432Switchgrass PhyllosphereLRPLHINDDILGHQNGAVPTPFFLPNLVSNHIAICLLFYHIRGAITFVPLVELGVDERTLDCELLLVLLILKLLPWLRTLVGLVASFVALEAS
Ga0182196_105629913300017432Switchgrass PhyllosphereLRPLHIGDDFLRHPNGAVLTSFFLPYLVSNHLAIGLLFYHIGDAIAFVPPVGLGVDERTLNCKFLLVLLIRKLLPWLRTLVALVAFFVAL
Ga0182194_108363313300017435Switchgrass PhyllosphereLRPLHIGYDILGHPNGVIPTPFLLPNLVSNHLTICLLFDHIGGAISFVLLVGLGVDERTLDYELLLIFLIRKLLHWLRTLVGLVAFLMAFGASHGGPLL
Ga0182194_114542923300017435Switchgrass PhyllospherePSFQIPRSRSWASSLLWNPHHLRPLHFGDDVLGHPNGVIPNPFLLPNLVSNHLAIYLLFDHIGCAMAFVPPVGLGVDETTLDCEFLLVLLIRKLLPWLRTLVGLVAFFVAL
Ga0182200_112196813300017439Switchgrass PhyllosphereMPLHIGDDVLGHPNGVVPTHFFLPNLMSNHLTIGLLFDHIGGAIAFVPPVRLGVDERTLDCEFLLVLLIRKLLPWLRTLVGLVAFFVAL
Ga0182214_115901313300017440Switchgrass PhyllosphereLRALHIGDDILGHPNRVVQTTFLLPNFVSNHLAICLLFDYIGGAIVFVPPVGLGVDERTLDCEFLLVLLIRKLLSWLRTLVGLVAFFVAL
Ga0182198_107397213300017445Switchgrass PhyllosphereLACFLVVIGDDIFGHQNGVIPTPFLLPNFASNHLAINFLFDHIGGSITFVSPVGLGVDERTFDCEFLLVLLIRKLLLWLRTLVGLVAFFMAL
Ga0182198_109674713300017445Switchgrass PhyllosphereLKHLHVGDDFFGHPNRAVPTPILLPNLVSNHLAIVLLLDHIGGAFTLVLPVGLGVAERTLDCELLFVLLIQKLFLWLRALVGLVAFLMALETCHGRPLLRL
Ga0182198_113185323300017445Switchgrass PhyllosphereLSPLHVSNDFLGHPNVAVPTHFLLPNLVRNHLVIGLLFDHIGDAIAFVPPVGLGVYERTLDCEFLFVLLIRKLLPWLRTLVG
Ga0182198_118908313300017445Switchgrass PhyllosphereLRPLHIDDHILGHPNEAVPTLFLLPNLVSNQLAICFLLDHIGGAIAFFPPVGLGVDERTFDYKLLLILLIRKLLPWLRTLV
Ga0182198_119286523300017445Switchgrass PhyllosphereMPLHIGDDILGHPNRVILTPSLLPNLLSNHIAICFLLNHIGDAIAFVPPVGLGVDERTLDYKVLLVLLIRKLLLWLRALVGLVAFCMAL
Ga0182198_120296913300017445Switchgrass PhyllosphereLRSLHVGEDFLGHPNGAVPTPILLPNLVSNHLAIGFLLHHIGGAIAFVTSVGLGVDERTLDCEFLLVLFIRKLLPWLRTLLGLVAFFVAF
Ga0182210_109675423300017692Switchgrass PhyllosphereLRPLQVGDDVLGHPNGVVPTPFLLPNLVSNHLTIGLLFNHIGGAIVFVSPVGLGVDERTLDCEFLLVLLIRKLLLWLRTLIGLVAFFVPL
Ga0182216_110407213300017693Switchgrass PhyllosphereLRPLHIGDDIFGHPTGVIPTPFLLPNFVSNYLAIDILLDHIGGAITFIPLVGLGVDERTFDCEFLFVLLIRNLHLWLTTLVELVAFMMAL
Ga0182216_111402313300017693Switchgrass PhyllosphereLRPLHVDDDVIGHPNRVVPTPFLLPNLVSNHLAIGLLFDHIGGAIAFVPPVGLGVDERTLDCELLLVLLIRKLLPWLRTLVGLVAFFVAL
Ga0182211_111710113300017694Switchgrass PhyllosphereLRPLHIVDDFLGLSNGVVPIPFLLPNLMSNYVVIVLLFYHIECTIAFVPPVGLGVDERTLDFKFLLVLLIRKLLPWMRTLVGLVAFFVAL
Ga0182119_10512113300020031Switchgrass PhyllosphereLRPLHVGDDVLGHPNGVVPTPFLLPNLVSNHLAIGLLFDHIGGAIAFVPPVGLGVDERTLDCELLFVLLIRKLLPWLRTLVGLVAFFVALRASHGGPLLKLLHHVLMV
Ga0213505_12050513300022465Switchgrass PhyllosphereTFSLLSNLVSNHLALGFLLDHIGGAMTLVPLVGLDVDERTLDCEFLLILLIRKLLLWLRTLVGLMAFFVTL
Ga0213504_10553013300022466Switchgrass PhyllosphereLRPLHVGDDVLGHPNGAVPTTFLLPNLVSNHLAICFLLDHIGGAIALVPPIGLGLDERILDCEFLFVLLIRKLLPWLRTLIVLVAFFVAL
Ga0207673_103862223300025290Corn, Switchgrass And Miscanthus RhizosphereLRPVQVGDDILGHPNGVVPTPFLLPNLVSNHLAIGLLFYHIGGAIAFVPLVGLGVDERTLDCEFLFVLLIRKLFLWLRAFVGLVAFFVAF
Ga0207650_1051844023300025925Switchgrass RhizosphereLPNGVVPTSFLLPNLVSNHLAIGLLFYHIGGAIAFVPPVGLGVDERTLDCELLLVLLIRKLLPWLRTLVGLVAFFVAL
Ga0207670_1127978913300025936Switchgrass RhizosphereHSWASSLLWNPHHLGPLHIGDDILGHPNGVIPTPFLLPNLVSNHLAIGLLFYHIGDAIAFVPPVGLGVDERTLDCDLLFVLLIRKLLPWLRTLVGLVAFFVAL
Ga0207711_1194269413300025941Switchgrass RhizosphereLRPLHIDDDILGHPNGMVPTPFLLPNLVSNHLAIGLLFYHIGGAIAFVPPVGLGVDERTLDCELLFVFLIRKLLPWLRTLVGLVAFFVAL
Ga0268328_106879823300028050PhyllosphereGYPNRVIPTPFLLPNLVSNHLAIDFLLDHIGGAITLVPPVGLGVDERTLDCEFLLVFFIRKLLPSLRILVGLVAFMMAL
Ga0268306_102058023300028054PhyllosphereLRPLHIGDDILGHSNGVIPTPFLLPNLVSNHLAICFLLDHISGAIALVPSVELGVDERTLDCEFLLVLLIQKLLPWLRTLVELVAFMMAL
Ga0268338_100628323300028055PhyllosphereLRPLHIGDDFFGHPNGVIPTPFLLPNLVSNHIAICHLFDHIGGAMALVPSVGLGVNERTLDCKLLFVLLIRKLLLWLMELVGLVAFLMAFRESHGGPLLKLLHHASRLS
Ga0268338_104341113300028055PhyllosphereLRPLHIGDDILGHPNGVIPTPFLLPNLVSNHLAIYFLLDHIGGAMTLVPPVGLGVDERTLDCEFLLVLLIRKLLPWLRTLVGLVAFFVALGASHGGPLLKL
Ga0268332_102589423300028058PhyllosphereNLVSNHLAIGFLLDHIGGAITLVPPVGLGVDERTLDCEFLLVFFIRKLLPSLRILVGLVAFMMAL
Ga0268332_107983523300028058PhyllospherePPNSPKPFLALSLLWNPHHLRPLHIGDDILGHPNGVVLISFLLPNLVSNHLAIGLIFYHIGGAIDFVPPVGLGVDERTLDCELLFVPLIRKLLP
Ga0268340_101788813300028064PhyllosphereHFFLPNLVSNHLAIGFLLDHIGGAIILVPPVGLGVDERTLDCEFLLVFFIRKLLPSLRILVGLVAFMMAL
Ga0268347_101841513300028142PhyllosphereLRPLHIGYDILGHPNGVIPTPFLLPNLVSNHIAIGFLLDHIGGVIIFVSPVGLGVDERTLDCKFLLVLLIRKLLPWLRTFVGLVALF
Ga0268348_101336423300028143PhyllosphereLRPLHVGDDVLGHPNGVVPTPFLRPNLVSNHLAIGLLFDHIGGAITFVPPVVLGVNERTLDYELLLVLSIRKLLSWLRTLVGL
Ga0268354_101682723300028148PhyllosphereSLLWNPHHLRPLHIGDDILGHPNRVIPTPFLLPNLVSNHLAIGFLLDHIGGAIAFVSLVGLGVDERTLDCELLLVLLIPKSFFFG
Ga0268312_103896713300028248PhyllosphereLRPLHVGDDFLGYPNGAVPTPILLPNLVNNHFAIVLLFDHIGGAFALVLPIGLGVDERTLDCDLLLVLLIRKLLLLL
Ga0268316_100879123300028253PhyllosphereLRPLHIDDDILGHPNGMVPTLFLLPNLVSNHLAICFLLDHIGGAIALVPSVGLGVDERTLNCEFLFVLLIRKFLPWLRTLVGLVAFFVALRASHGGPLLKLLHH
Ga0268316_101252413300028253PhyllosphereLRPLHIGDDILGHPNGVIPTPFLLPNIVSNHLAIGFLLDHIGGAIAFVSPVGLGVDERTLDCKLFLVLLIRKLLLWFRVLVGLVAFLWHFEQVTVDPFSSF
Ga0268316_101944913300028253PhyllosphereLRPLHVGDDFLGHPNGAVPTPILLPNLVSNHFAIVLLLDHIGGAFALVLPVGLGVDERTLDCDLLLVLLIRKLLPWLRTLVGLVAFFVAL
Ga0268316_102366013300028253PhyllosphereLRPLHIGDDVLGHPNGVVPTPFLLPNLVSNHLAICLLFYYIGGAIAFVPPVGLGVDERTLDCELLFVLLIWKLLPWLRTLVGLV
Ga0268310_104942813300028262PhyllosphereLRPHHIGDDILGYPNRVIPTPFLLPNLVSNHLAIGFLLDHIGVAITLVPPVGLGVDERTLDCEFLLVLFIRKLLPSLRILIGLVAFMM
Ga0268302_10193613300028464PhyllosphereLRPLHIGYDILGHPNGVIPTLFLLPNLVSNHLAIGFLLDHIGGAIAFVPPVGLGVDERTLDCKLLLVLLIRKLLPWLRTLVGLVAFFVAL
Ga0268323_100267723300028471PhyllosphereLRPLYIGDDILGHPNRVIPTPFLLPNLVSNHLAIGFLLDHIGDAIALVPPVGLGVDERTLDSEFLFVLLIRKLLLLLRTLVGLVAFMMAF
Ga0268315_101559623300028472PhyllosphereLSLQIPRSHSWASSLLWNPHHLRPLHIGDDFLGHPNGAVPTPIHLPNLVSNHLAIGLLFNHIGGAFTFVPPVGLGVDERTLDCELLFILLIRKLLPWLRAPVGLVTFFMAL
Ga0268327_102011113300028475PhyllosphereLRPLHIGDDVLGHPNGVVPTPFLLSNLVSNHLAIGLLFDHIGGAIAFVPPVVLGVDEKTLDCELLFVLLIRKLLPWLRTLVGLVAFFVALRASHDG
Ga0268305_10945013300028525PhyllosphereLRPLHIDDDILGHPNGAVPTPFLLPNLVSNHLAICFLLDHIGGAIAFVSPVGLGVDERTFDCKLLLILLIRKLLS
Ga0268305_11031913300028525PhyllosphereLWPLYVGDDFLGHRNRVAPTPFLLPNLANNHLTIALLLDNIDGAFVFVLPVGLGVDERTFDGELLLVLLIWKFLLWLRNLLDLWSS
Ga0214492_107769113300032464Switchgrass PhyllospherePKPSLILSLFCNPHHLRPLHIGDDILGHPNGVVPNPFLLPNLVSNHLGICFLFDHIGGALAFVPPVGLGVDERTLDCERLLVLLIRKLLPWLRTLVGLVAFFVAL
Ga0214493_100005423300032465Switchgrass PhyllosphereLRSLHVVDDFLGHPNGAVPIPILLPNLVGNHLAIALLLDHISGALALVLLVGLDIDERTLDGGIFLVLLIRKLLLGLRALV
Ga0214493_108948713300032465Switchgrass PhyllosphereLRPVQVGDDILGHPNGVVPTPFLLLNLVSNHLAIYLLFDYIGGAIAFIPPVGLGVDERTLYCEFLLVLLIRKLLPWLRTLIGLVAFFVAL
Ga0214493_116415113300032465Switchgrass PhyllosphereLRPLHVGDDVLGHLNGAVPTPFLLPNLVSNHLAICFLLDNIGGAIALVPPVGLGLDERILDCEFLFVLLIRKLLPWLRTLIVLVAFFVAL
Ga0214503_118938623300032466Switchgrass PhyllosphereLRPLHIGDDILGHPNGVVPTPFLFPNLMSNHFVIGLLFDHIGGAIAFVPPVGLGVDERTLDSEFIFVLLIRKLLLLLKTFVGLVDFMMAF
Ga0214488_100011833300032467Switchgrass PhyllosphereLRPLHIGDDILGHPNRVIPTSFLLPNLVSNHLAIGFLLDHVGGAIAFVPPVGLGVDERTLDCEFFLVLLIRKLLLWLRTFVGLVAFRMAL
Ga0214488_105872523300032467Switchgrass PhyllosphereLRPLHVGDDVLGHPNGVVPTPFLLPNLVSNHLAICFHLDHIGGAIALVPPIGLGLDERILDCEFLFVLLIRKLLPWLRTLIVLVAFFVAL
Ga0214488_111894413300032467Switchgrass PhyllosphereLRPLHVGDDVLGHLNGAVPTPFLLPNLVSNHLAICFLLDNIGGAIALVPPVGLGLDERILDCEFLFVLLIRKLLPWLRTLI
Ga0214482_100651123300032468Switchgrass PhyllosphereLRSLHVVDDFLGHPNGAVPIPILLPNLVGNHLAIALLLDHISGALALVILVGLDIDERTLDGGIFLVLLIRKLLLGLRALV
Ga0214491_100091413300032469Switchgrass PhyllosphereLRSLHVVDDFLGHPNGAVPIPILHPNLVGNHLAIALLLDHMSGALALVLLVGLDIDERTLDGGIFLVLLIRKLLLGLRALV
Ga0214491_107878633300032469Switchgrass PhyllosphereRPNGVIPTPFLLPNLVRNHLVICLLFDHIGGAMALVPPVGLGVDERTFDCKLLLVLLIRNFLLWLRALVGLVVFVMTL
Ga0214491_112973613300032469Switchgrass PhyllosphereLRPLHIGDNVLGHLNGVVPTPFLLPNLVSDHLAIDLLLDHIGGAIAFVPPVGRSVDERTLDCERLFVLLIRKLLPWLRTLVGLVAFFVTL
Ga0214495_100960533300032490Switchgrass PhyllosphereLRPLHVGDDVLGHLNGAVPTPFLLPNLVSNHLAICFLLDNIGGAIALVPPVGLGLDERILDCEFLFVLLIRKLLPWLRTLIVLV
Ga0214502_100253623300032514Switchgrass PhyllosphereLRSLHVVDDFLGHPNGAVPIPILLPNLVGNHLAIALLLDHISGALALVLLVGLDIDERTLDDGIFLVLLIRKLLLGLRALV
Ga0214502_135733823300032514Switchgrass PhyllosphereLRPLHIGYDIFGHPNRVIPTPFLLPNLVSNHLAIDFLLDHIGGAITFVSSIVLGVDERTLDCKVLLVLLIRKLLPWLRALVGLVAFRMAL
Ga0214483_105372113300032548Switchgrass PhyllosphereLRPLHIDDDILGHPNGTVPTLFLLPNLVSNHLAICFLLDHIGGAIALVPPIGLGLDERILDCEFLFVLLIRKLLPWLRTLIVLVAFFVAL
Ga0214483_106760623300032548Switchgrass PhyllosphereDFLGHPNGAVPIPILLPNLVGNHLAIALLLDHISGALALVLLVGLDIDERTLDGGIFLVLLIRKLLLGLRALV
Ga0321340_102142813300032550Switchgrass PhyllosphereLRSLHVVDDFLGHPNGAVPIPILLPNLVGNHLAIALLLDHMSGALALVLLVGLDIDERTLDGGIFLVLLIRKLLLGLRALV
Ga0321340_105945613300032550Switchgrass PhyllosphereLRPLHVGDDVLGHLNGAVPTPFLLPNLVSNHVAIFFLLDYISGAIALVPPVGLGLDERILDCEFLFVLLIRKLLPWLRTLIVLVAFFVSL
Ga0321339_100039033300032551Switchgrass PhyllosphereLRSLHVVDDFLGHPNGAVPIPILLPNLVGNHLAIALLLDHISGALALVLLVGLDIDERTLDGGIFLVLLIWKLLLGLRALV
Ga0321339_100738333300032551Switchgrass PhyllosphereGDNVLGHPNGVVPTPFLLPNLVSDHLAIGFLFYHIGGAIAFVPPVGLSVDERTLDFEFLLVLLIRKFLLWLRALI
Ga0321339_106432713300032551Switchgrass PhyllosphereMPLHNDDDILGLPNGAVPTPFLLPNLVSNHVAIFFLLDYISGAIALVPPIGLGVDERTLDCKLFLVLLIRKLLPWLRTLIVLVAFFVAL
Ga0321339_111155613300032551Switchgrass PhyllosphereHSWASSLLWNPHHLRPLHIGDDVLGHPNGVVPTPFLLPNLVSNHLAIGFLLDHIGGAIAFVPPVGLGVDERTLDCKLLLVLLIRKLLPWLRTLVGLVAFFVAF
Ga0214500_109074313300032589Switchgrass PhyllosphereLRPLHIGDDVLGHPNGVVPTPFLLPNLVSNHLAIGLLFDHIGGAIAFVLPVGLGVDERTLNCELLFVLLIRKLLPWLRTLVGLVAFFVAL
Ga0214500_117234613300032589Switchgrass PhyllosphereLRPLHVGDDVLGHPNGAVPTPFLLPNLVSNHLAICFLLDNIGGAIALVPPVGLGLDERILDCEFLFVLLIRKLLPWLRTLIVLVAFFVAL
Ga0214489_103386513300032590Switchgrass PhyllosphereLVLSLLWNSHHFRPLHIGDDVLGHPNGVVPTPFLLPNLVSNHLAIGLLFNHIGGAIAFIPPVGLGVDERTLDCELLLVLLIRKLLPWLRTLVALVVFFVTL
Ga0214489_106376613300032590Switchgrass PhyllosphereLRPLHIGDDILGHPNGVISTLSLLPNLVSNHLAIGFLLDHIGGAMTLVPLVGLDVDERTLDCEFLLILLIRKLLLWLRTLVGLVAFMMTL
Ga0214484_109971613300032591Switchgrass PhyllosphereLRPLHVGDDFLGHPNGVVPTSIFLPNLVSNHLPIVLLLDHISGAFALVLPVGLGVDERTLDSNLLLVLLIRKLLLWLRAFVGLVAF
Ga0321338_132780013300032593Switchgrass PhyllosphereLRPLHVGDDVLGHPNGAVPTPFLLPNLVSNHLAICFLLDNIDGAIALVPPVGLGLDERILDCEFLFVLLIRKLLPWLRTLIVLVAFFVAL
Ga0214501_113001413300032625Switchgrass PhyllosphereLRPLHVGDDVLGHPNGAVPTTFLLPNLVSNHLAICFLLDHIGGAIALVPPIGLGLDERILDCEILFVLLIRKLLPWLRTLIVLVAFFVAL
Ga0214497_107912613300032689Switchgrass PhyllosphereLRPLHVGDDFLRHPNGVVPTPVLLSNLVSNHLTIALLLDNIGGAFDFIPLFGLGVDERTLDSEFLFVLRIRKLLLLLRTLVGLVAFMMAF
Ga0214499_104684323300032697Switchgrass PhyllosphereLRSLHVVDDFLGHPNGAVPIPILLPNLVGNHLAIALLLDHMSGALALVLLVGLDIDERTLDGGIFLVLLIWKLLLGLRALV
Ga0214499_107110913300032697Switchgrass PhyllosphereLRPLHIGDDVFGTQMDPLYIGDEVLGHPNGVVPTPFLLPNFVCNHLAIGLLFYHIGGVIAFVPPVGLGVDERTLDCELLLVLLIRKLLLWLRTLVGLVAFFVAL
Ga0214485_105739213300032698Switchgrass PhyllosphereLRPLHVGDDFLGQPNGAVPTTFLLPNLVSNHLAIALLLDHIGGAFAFALAVGLGVDERTLECDFLLFLLIQKLLLWSRAFVGLVTS
Ga0214494_104997713300032699Switchgrass PhyllosphereLRPLHVGDDVLGHPNGVVPTPFLLPNLVSNHLAICFLLDNIGGAIALVPPVGLGLDERILDCEFLFVLLIRKLLPWLRTLIVLVAFFVAL
Ga0214494_105557113300032699Switchgrass PhyllosphereLRPLQIDDDILGHPNGAVPTPFLLPNLVSNHLAIYFLLDHIGGAISFVPPVGFGVDERTFDCKLLLVLLIRKLLPWLRTLVGLVAFFVALRASHGGPLLKLL
Ga0214494_109128813300032699Switchgrass PhyllosphereLRPLHVGDDFLGHPNGVVPTSIFLPNLVSNHLPIVLLLDHISGAFALVLPVGLGVDERTLDSNLLLVLLIRKLLLWLRAFVGLVAFLKALEACH
Ga0314733_107724523300032761Switchgrass PhyllosphereSSLLWNPHHLRPLHIGDDVLGHPNGVVPTPFLLPNLVSNHLAIGLLFYHIGGAIAFVPPIGLGVDERTLNCELLLVLLIRKLLSWLRTLVGLVAFFVAL
Ga0314742_103961313300032781Switchgrass PhyllosphereMMTSLGTQMGRFQLFFLLPNLVSNYLTICFLLDHIGGAIAFVPPVGLGVDERTLDCDLLLVLLIRKLLPWLRTLVGLVAFFVAL
Ga0314742_106258423300032781Switchgrass PhyllospherePNPPLQFLGFKSSLEPTPFEALHIGDDILGHPNGVIPTPLLLPNLVSNHLAIYLLFYHIGGAMTFVPLVGLGVDERTFDCKLLLVLLIRNFLLWLRALVGLVVFVMTL
Ga0314725_100620313300032789Switchgrass PhyllosphereLRSLHVVDDFLGHPNGAVPIPILLPNLVGNHLAIALLLDHMSGALALVLLVGLDIDERTLDGGIFLVLLIRKLLLGLRPLV
Ga0314748_105839313300032791Switchgrass PhyllosphereLRPLHVGDDVLGHPNGAVPTPFLLPNLVSNHLAICFHLDHIGGAIALVPPIGLGLDERILDCEFLFVLLIRKLLPWLRTLIVLVAFFVAL
Ga0314744_100887413300032792Switchgrass PhyllosphereHHLRPLHVGDDFLGYPNGAVPTPILLPNLVSNHFAIGLIFYHIGGAIIFVPPVGLGADERTLDCELLLVLLIRKLLPWLRTLIGLVAFFVAL
Ga0314718_102428913300032811Switchgrass PhyllosphereLRPLHIDDDVLGHPNGAVPTSFLLPNLVSNHLAIYFLLDHIGGAIALVPPVGFGVDERTLDCKLLLVLLIRKLLPWLRALVGLVAFFVAL
Ga0314740_100748323300032822Switchgrass PhyllosphereGDDVLGHPNGAVPTTFLLPNLVSNHLAICFLLDHIGGAIALVPPIGLGLDERILDCEFLFVLLIRKLLPWLRTLIVLVAFFVAL
Ga0314723_108931813300032823Switchgrass PhyllosphereLRPLHIGDDVLGHPNGVVPTPFLLPNLVSNHLAIGLFFNHIRGAIAFVPPVGLGVDGRTLDCELLLVLLIRKLLPWLRTLVGLVAFF
Ga0314723_110289413300032823Switchgrass PhyllosphereLRPLQIGDDIFGYPNGVVPTPFLLPNLVSNHLAIGLLFYHIGGAIAFVPSVGLSVDERTLNCELLLVLLIRKLLSWLRTLVGLVAFFVAL
Ga0314735_100068763300032824Switchgrass PhyllosphereLRSLHVVDDFLGHPNGAVPIPILLSNLVGNHLAIALLLDHISGALAFVILVGLDIDERTLDGGIFLVLLIRKLLLG
Ga0314735_110255213300032824Switchgrass PhyllosphereLRPLHVGDDVLGHPNGAVPTPFLLPNLVSNHLAICFLLDNIGGAIALVPPVGLGLDERILDCEFLFVLLIRKLLPWLRTLIVLV
Ga0314743_104476613300032844Switchgrass PhyllosphereLRPLHVGDDILGYPNGVVSTLFLLPNIMSNHLAIGLVFYHIGGAIGFVPPVGLGVDERTLDCEFLLVLLIRKLLPWLRTLVGPSLWHFEQVMVDPFSSFFTMSSRL
Ga0314743_110740023300032844Switchgrass PhyllosphereVIPTSFLLSNLVSNHLAICLLFYHIGGAIAFVPPVGLGVDEITLDYELLIVLLIRKLLLWLRAFAGLLAIVMAL
Ga0314727_105981213300032845Switchgrass PhyllosphereLSPLHVGDDVLGHPNGAVLTTFLLPNLVSNHLAICFLLDHIGGAIALVPPIGLGLDERILDCKFLFVLLIRKLLPWLRTLIVLVAFFVAL
Ga0314737_101382113300032875Switchgrass PhyllosphereLRSLHVVDDFLGHPNRAVPIPILLPNLVGNHLAIALLLDHISGALALVLLVGLDIDERTLDGGIFLVLLIWKLLLGLRALV
Ga0314737_105883023300032875Switchgrass PhyllosphereWASSLLWNPHHLRPLHIDDDILGHPNGAVPTPFLLPNLVSNHLGICFLLDHIGGAIALVPPIGLGLDERILDCEFLFVLLIRKLLPWLRTLIVLVAFFVAL
Ga0314739_102094513300032913Switchgrass PhyllosphereLRPLHIGDDVLGHPNGVVPTPFLLPNLVSNHLAIGLVFYHIGGAIGFVPPVGLGVDERTLDCEFLLVLLIRKLLPWLRTLVGLVAFFVTL
Ga0314739_102758013300032913Switchgrass PhyllosphereLRSLHVVDDFLGHPNGAVPIPILLPNLVGNHLAIALLLDHMSGALALVLLVGLDIDERTLDGGIFLVLLIRKLLLGLR
Ga0314749_109900013300032915Switchgrass PhyllosphereVGDDFFAHPNGAVPTPFLLPNLVSNHLAIGLLFDYIGGAIAFVPPVGLGVDERTLNCEFLFVLLIRKLLSWLRTLVVLVAFFVAL
Ga0314749_109923413300032915Switchgrass PhyllosphereLRPFHIGDDILGHPNGVIPTPSLLPNLVSNHLAIGFLLDYIGGAMALIPPVMLGVDERTLDCEFLLVLLIRKL
Ga0314721_12139623300032917Switchgrass PhyllosphereLSPLQVGDDIFGHPNGVVPTPFLLPNLVSNHLAIGLLFDYIGGAIAFVPPVGLGVDERTFDCELLLVLLIRKLLPWLRTLVGLVAFFVAL
Ga0314726_11607113300032918Switchgrass PhyllosphereLRPLHVGDDVLGHPNGAVPTTFLLPNLVSNHLAICFHLDHIGGAIALVPPIGLGLDERILDCEFLFVLLIRKLLPWLRTLI
Ga0314741_107183113300032934Switchgrass PhyllosphereLRSLHVGDNFFGHPNIAVPTPLLLPNLVSNHLIIDLFFNHIEGAIAFGPPVGLGVDDRTLDCSFFLVLRIRKLLLWYRIFVGLVIFLMALETCHGGPLLKLLHRLTIILRMLKIALYALA
Ga0314729_11728213300032953Switchgrass PhyllosphereLRPLHVGDDVLGHPNGVVPTPFLLPNLVSNHLAICFHLDHIGGAIALVPPIGLGLDERILDCEFLFVLLIRKLLPWLRTLIVLVAFFV
Ga0314716_14319913300032970Switchgrass PhyllosphereLRPLHIGDDILGHPNGVIPTPFLLPNLVSNHLAIGFLLDYIGGAMALVPSVGLGVNERTLDCKLLFVLLIRKLLLWLRELVGLVAFLMAFRESHGGPLLKLLHHASR
Ga0314768_114312313300033523Switchgrass PhyllosphereLRPLHVGDDVLGHPNGAVPTPFLLPNLVSNHLAICFFLDNIGGAIALAPPVGLGLDERILNYEFLFVLLIRKLLPWLRTLIVLVVFFVAL
Ga0314758_116470913300033525Switchgrass PhyllosphereLRPLHVGDDVLGHPNGAVPTPFLLPNLVSNHLAICFLLDNIDGAIALVPPVGLGLDERILDCEFLFVLLIRKLLPWLR
Ga0314761_113317713300033526Switchgrass PhyllosphereLRPLHVGDDVLGHPNGAVPTTFLLPNLVSNHLAICFLLDHIGGAIALVPPIGLGLDERILDCEFLFVLLIRKLLPWL
Ga0314760_101427443300033530Switchgrass PhyllosphereFTSTCKLSLQIPRSHSWASSLLWNPHHLRPLHVGDDVLGHPNGVVPTPFLLPNLVSNHLAICFHLDHIGGAIALVPPIGLGLDERILDCEFLFVLLIRKLLPWLRTLIVLVAFFVAL
Ga0314756_104454913300033531Switchgrass PhyllosphereLRPFHIGDDILGHPNGVIPTPSLLPNLVSNHLAIGFLLDHVGGAIAFVPPVGLGVDERTLDCEFFLVLLIRKLLLWLRTLVGLVAFMMTL
Ga0314770_118077113300033533Switchgrass PhyllosphereNGAVPTTFLLPNLVSNHLAICFLLDHIGGAIALVPPIGLGLDERILDCEFLFVLLIRKLLPWLRTLIVLVAFFVAL
Ga0314770_120689523300033533Switchgrass PhyllosphereRSHSWASSLLWNPHHLRPLHIGDDILGHPNRVIPTSFLLPNLVSNHLAIGFLLDHVGGAIAFVPPVGLGVDERTLDCEFFLVLLIRKLLLWLRTFVGLVAFRMAL
Ga0314762_107124613300033539Switchgrass PhyllosphereLRSLHVVDDFLGHPNGAVPIPILLPNLVGNHLAIALLLDHISGALAFVILVGLDIDERTLDGGIFLVLLIRKLLLG
Ga0314769_102927133300033542Switchgrass PhyllosphereLRPLHVGDDVLGHPNGAVPTPFLLPNLVSNHLAIGFLFDYIGGAIAFVPPIGLGIDKRTLDCKLLLVLLIRKLLPWLRALVGLVAFFVAL
Ga0314769_114318023300033542Switchgrass PhyllosphereLRSLHVVDDFLGHPNGAVPIPILLPNLVGNHLAIALLLDHISGALALVILVGLDIDERTLDGGIFLVLLIRKLLLG
Ga0314769_119398113300033542Switchgrass PhyllosphereLRPLHIDDDILGHPNGAVPTPFLLPNLVSNHLAICFLLDNIGGAIALVPPVGLGLDERILDCEFLFVLLIRKLLPWLRTLIVLV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.