NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300032789

3300032789: Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300032789 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0128851 | Gp0330579 | Ga0314725
Sample NameMetatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size63288639
Sequencing Scaffolds47
Novel Protein Genes56
Associated Families45

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae4
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum5
Not Available20
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum2
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae1
All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Miaviricetes → Ourlivirales → Botourmiaviridae1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum6
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NamePhyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa
TypeHost-Associated
TaxonomyHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere → Phyllosphere Microbial Comminities From Bioenergy Crops Switchgrass And Miscanthus From Michigan, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Unclassified

Location Information
LocationUSA: Michigan
CoordinatesLat. (o)42.3956Long. (o)-85.372Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000255Metagenome / Metatranscriptome1449Y
F000459Metagenome / Metatranscriptome1109Y
F000927Metagenome / Metatranscriptome831Y
F001705Metagenome / Metatranscriptome648Y
F010664Metagenome / Metatranscriptome300Y
F012944Metagenome / Metatranscriptome275Y
F013050Metagenome / Metatranscriptome275Y
F014095Metagenome / Metatranscriptome265Y
F014470Metatranscriptome262Y
F016911Metagenome / Metatranscriptome243Y
F018302Metagenome / Metatranscriptome235Y
F020484Metagenome / Metatranscriptome223Y
F023769Metagenome / Metatranscriptome208Y
F024696Metagenome / Metatranscriptome204Y
F025200Metagenome / Metatranscriptome202Y
F026180Metagenome / Metatranscriptome198Y
F026461Metagenome / Metatranscriptome197Y
F028072Metagenome / Metatranscriptome192N
F029306Metagenome / Metatranscriptome188Y
F030332Metagenome / Metatranscriptome185Y
F030953Metatranscriptome183N
F032517Metagenome / Metatranscriptome179Y
F032897Metagenome / Metatranscriptome178Y
F033278Metagenome / Metatranscriptome177Y
F035610Metagenome / Metatranscriptome171Y
F036567Metagenome / Metatranscriptome169Y
F037522Metagenome / Metatranscriptome167Y
F038940Metagenome / Metatranscriptome164Y
F042357Metagenome / Metatranscriptome158Y
F049431Metagenome / Metatranscriptome146N
F053757Metagenome / Metatranscriptome140Y
F055385Metagenome / Metatranscriptome138Y
F056280Metagenome / Metatranscriptome137Y
F057814Metagenome / Metatranscriptome135Y
F067332Metagenome / Metatranscriptome125N
F068339Metagenome / Metatranscriptome124Y
F069562Metagenome / Metatranscriptome123Y
F076725Metagenome / Metatranscriptome117Y
F084981Metagenome / Metatranscriptome111Y
F094644Metagenome / Metatranscriptome105N
F096411Metagenome / Metatranscriptome104Y
F096451Metagenome / Metatranscriptome104Y
F100267Metagenome / Metatranscriptome102N
F102251Metagenome / Metatranscriptome101Y
F104115Metatranscriptome100N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0314725_1000368All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta3031Open in IMG/M
Ga0314725_1000730All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae2545Open in IMG/M
Ga0314725_1001042All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Ascomycota → saccharomyceta → Pezizomycotina → leotiomyceta → sordariomyceta → Sordariomycetes → Sordariomycetidae → Diaporthales → Gnomoniaceae → Ophiognomonia → Ophiognomonia clavigignenti-juglandacearum2317Open in IMG/M
Ga0314725_1002050All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor1933Open in IMG/M
Ga0314725_1002494All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1837Open in IMG/M
Ga0314725_1002737All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1791Open in IMG/M
Ga0314725_1003706All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae1631Open in IMG/M
Ga0314725_1004456Not Available1533Open in IMG/M
Ga0314725_1004579All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii1522Open in IMG/M
Ga0314725_1005777Not Available1401Open in IMG/M
Ga0314725_1005885All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum1393Open in IMG/M
Ga0314725_1006203All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum1366Open in IMG/M
Ga0314725_1008700All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta1200Open in IMG/M
Ga0314725_1008735Not Available1199Open in IMG/M
Ga0314725_1011808Not Available1054Open in IMG/M
Ga0314725_1015357All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor933Open in IMG/M
Ga0314725_1017033All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum887Open in IMG/M
Ga0314725_1017988Not Available862Open in IMG/M
Ga0314725_1020302All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae813Open in IMG/M
Ga0314725_1020781Not Available804Open in IMG/M
Ga0314725_1023303All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Miaviricetes → Ourlivirales → Botourmiaviridae757Open in IMG/M
Ga0314725_1023669Not Available750Open in IMG/M
Ga0314725_1024323All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum739Open in IMG/M
Ga0314725_1026488Not Available706Open in IMG/M
Ga0314725_1027765All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum688Open in IMG/M
Ga0314725_1028377All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum680Open in IMG/M
Ga0314725_1028944All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Castanea → Castanea mollissima673Open in IMG/M
Ga0314725_1029215Not Available669Open in IMG/M
Ga0314725_1030062All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum658Open in IMG/M
Ga0314725_1030554Not Available652Open in IMG/M
Ga0314725_1030766All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum649Open in IMG/M
Ga0314725_1030896Not Available648Open in IMG/M
Ga0314725_1032636All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum628Open in IMG/M
Ga0314725_1033315Not Available620Open in IMG/M
Ga0314725_1033753All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta615Open in IMG/M
Ga0314725_1034431Not Available608Open in IMG/M
Ga0314725_1035085Not Available602Open in IMG/M
Ga0314725_1036930All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae583Open in IMG/M
Ga0314725_1037115Not Available582Open in IMG/M
Ga0314725_1037705All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum576Open in IMG/M
Ga0314725_1038742Not Available567Open in IMG/M
Ga0314725_1039545Not Available561Open in IMG/M
Ga0314725_1041865Not Available542Open in IMG/M
Ga0314725_1043412Not Available530Open in IMG/M
Ga0314725_1044605Not Available521Open in IMG/M
Ga0314725_1045059All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum518Open in IMG/M
Ga0314725_1045658All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum513Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0314725_1000368Ga0314725_10003681F042357MDLKPTRNSLGRNPLSDALHRNPGVVINGQGPGRHPPKGASYHDLGTMISEQGSGRHLNGALHLRPGVVKNEQGSSHFRRRVRRVRKLAEPTRIRICSWNVGSLTGKLRELV
Ga0314725_1000730Ga0314725_10007302F035610MHESTIYLTTLIELFVHIDREKHSLRVLTPSETTKDKLINS
Ga0314725_1001042Ga0314725_10010421F013050MSKGKQPRTRVKVPKLMLSEIKEVFIIYNQEIGLEAAIF
Ga0314725_1002050Ga0314725_10020503F036567AAASSNFYPLFLSYLAPEMNTKVVPNFIGNLLAKFQPKRIGIAGENRKLQKLCFL
Ga0314725_1002494Ga0314725_10024942F032897HIGVDAFFTRSHCQQNTIALQHVPSELQVADFFTKAQTQEQHRLHLLKLNASDPPLPP
Ga0314725_1002737Ga0314725_10027373F096411CSQGWEARKELELLHLVAQGCHHQYEGASNGVGSKGHLMPKNGFEGFGGLAT
Ga0314725_1003706Ga0314725_10037062F028072LYLRELKYSVKIEKLHYLNLEVNTGKTVSTKENINIRCRINSSEEHTWHTSHGQTNLIVDLIHNFYITWGKRQDDLELKFEKLQKEHKHLEEQYLVANKKLELALQALEESKILLGKISQNSDYIKRDISYLFNKLESTNIAEHSKEIVLSSSGILEVTRSLNSDKWKYLTASLEETSVS
Ga0314725_1004456Ga0314725_10044561F000927MGSGATNFTGASTKHLLSTKIFPNFIHLYSRGDKKNKISKLLTKIKSTESYTRDMVLKFLLEPSHEINILHKNYQALYPPDKLVMQLT
Ga0314725_1004579Ga0314725_10045791F026461FRVMLFFIAVKNVLKHTTLYVHCVDLLIWSPTQLDFLFYDFFVIYYDFSKLL
Ga0314725_1005777Ga0314725_10057772F020484MAKTLDAARSEIRNRLQRWDKMDTTLLFGINFGRIRTRWKVKSVHFAMEQCFSTCSVLEIERKIREDEAAMGQRGIEGGDDDEKQRLGP
Ga0314725_1005885Ga0314725_10058852F001705RGRPKLTWDESVKRDLKDWNISKEIALDRSAWRLAINVPES
Ga0314725_1006203Ga0314725_10062031F025200LRSLHVVDDFLGHPNGAVPIPILLPNLVGNHLAIALLLDHMSGALALVLLVGLDIDERTLDGGIFLVLLIRKLLLGLRPLV
Ga0314725_1008065Ga0314725_10080651F030953GSRGEAVRVSHGQMQGAYLSFPLLCLHSYCAATWAARFDKEARFLVNGDDTVISAYRDVTVQDYPSGYRLNNDKTIRAGNAAEVNSTEFLKSKERWREVRHLRRGGAVTDFPGMMHMAKAVTVTPGFVDAYQRCRIGRRWGFLPSQLGHTTYPAYKRERGLRVRRTYTPLPEPADGCVFPEEMVRITGRDPTPVEQEALRSVQWKHGRWGGAKRDVFSPSCGKVRRSYHYRARPGFSYLSFVGPGRPKLSPLWEKGADWGLVPASFQTEEEERGLAELEQFRRNWDSGFISVGD
Ga0314725_1008700Ga0314725_10087001F001705RGRPKLKWDESVKRDLKDWNISKKIVLDRSAWRLAINVSEP
Ga0314725_1008735Ga0314725_10087351F100267MLLNVKFSLSLRILGLDHYQFPCSCQAFAYIASRNSPFDPIHLFSRVLLNSHXFLHYNENHFFHTCLIIKYHLQFLXQFFQYMRLYISIQSCLILNTLTCHFEYHILQQALFRYGSEFFTNNTYPNSHNTHCLLSFSY
Ga0314725_1011808Ga0314725_10118082F076725FSNPRGTSTLVAATKICIELLDCRTDPDPLAAGEGSGPLGTYSGERILVSWGGSEPSVAA
Ga0314725_1013011Ga0314725_10130113F102251LGVQNYVKNNDAKIIITFLNMHCDVHYYTAKFGIKIQLLYEETKKTNCFMG
Ga0314725_1013980Ga0314725_10139801F094644MKFIFLLXALRYQRYHSGIWHHCYCCSMPTKCSLHSGYCHTCVLRLLCNSNTWILQIXGKDIHLPFASPSSGFQQRMXYCQNHKXLFTLSFIKDLRSMAIYIRTDALECGYHFPSENDQVXQISHFNKSVIVQIHEHRNAKSNIWLNYTSNSLETSEFFGIFXNSLQQATLEKDHISMGNNIRLNTYYHMWYDVHYKNIMYLRH
Ga0314725_1015357Ga0314725_10153571F010664MGDNHNNENHEALPQQPPSLAQAVAALIADRNEQTELIRQLVQAQANVGRGRHAPPPPAETDYVGFLTTQPPLFHKADDPLEADAWIRTIEDKFSILNCAEM
Ga0314725_1017033Ga0314725_10170331F055385MDPFRPAPRFDGTGFQRWKVLMQAHLQATGLNVWRVVSDGMKKNGGQQEKQHDVTAKCIILSSLSDNMFNRVYSCENAKELWKTIIENHEGTDDT
Ga0314725_1017988Ga0314725_10179881F024696RCIALRPLGGIYRSTWFGGQVASPRDKEGYPGITINPKLTISGVA
Ga0314725_1020302Ga0314725_10203022F069562MSMGNYLSILPLIAPLLLDLLNPNLGPQLSESNAPKWLGEDVPELSSSLDILELDASSIDTVTDEVIFDV
Ga0314725_1020781Ga0314725_10207811F033278MIRSNTSKYSPRGFQASSEISFLISARKSLPTSDQTFDVTF
Ga0314725_1023303Ga0314725_10233031F023769LKETLLTWSMPCADLHKNAFQRSSSRVAHVTRPVDNPTSGSTVKRCRDCLRGERDTKETIHNGLLLLRVRYGLPYAELPDCGPGDLSRFLSFLLLQGKERTSVAFPRRQRPGENGLCTLQRLCRRDRWALAHGCSSIKRNLPKGCFRHTPSVFAAWEAAALSQPPPLTSGYLEHVRRVVTGIFRPGWDRNYNSFVGSHVPNPSARACKTRADVLWRRRRDEFFTATTSESVINPSELAGRYKEIRSAGKSRP
Ga0314725_1023669Ga0314725_10236692F026461QQKNILKHTILYVHCVDLLIWSLTQLDFLFYNFSVIYCDFSKLI
Ga0314725_1023889Ga0314725_10238891F000459VRNGVLERVDNVKRGRGRPKLTCDESVKRDLKDWNISKEIALDRSVWRLAINVPEP
Ga0314725_1024323Ga0314725_10243231F056280MAFLLCYQGFPPQRFFYHRWHICRCPGGGDLGIDSDGGSRCGTFRYGVLLLT
Ga0314725_1026488Ga0314725_10264881F029306MQTKLNKSKNIIIKTSHENKANKTSFAILSLSCKEFYIKPHFGQQARNLNKTLTNSKQTCEQVAPLKTTPHKESNKIWFGIFLALHK
Ga0314725_1027135Ga0314725_10271351F057814MQGNKAIQQYMRNFTMIEKIGTVHLIKSYGSEGRKYPEVRRIKYLVLPKCGTKYQKVGLNTNLI
Ga0314725_1027685Ga0314725_10276851F057814KTLSSFTMIEKIGAVHLIESYGGEGRKYLGVPRIKYMVLKCGIKYQKVGSNTNLI
Ga0314725_1027765Ga0314725_10277651F030332MDLREQLAALFLGNAPHEDTTGTTAVEIPFYHRVAFSQSDYALSRDIVVREDVIFQVSPDLGDPCIGSFQSRWRWLREVTRILNRAHSPGRAP
Ga0314725_1028377Ga0314725_10283771F018302EDVYHVSAAVRLQAAACGLLARHRLHEMRRQMHEASLTAIDLGKGGRVLAPPDGHQQSHGSAAVYMREQGVVSAVGELQLCGSGSFRFVTGEDAQFSATTFRYRPPRGRLRWSWSRLILGGRTRAPLSFRWSPWDPGGYIRAGLARGGCPPYLQESKIKSRSLFKISRDVKGLFLGVRFVSSRVIVSVIVRLQLEDELPMLLAR
Ga0314725_1028944Ga0314725_10289441F049431GRINQVTILSPSAEAREQTPRRRPGCTGRKGRRRSEPQPQASEVCETPKPQATDSIAPTEFPKLRSATGGIRLLHRSLHRYIRPSGGEDSRQVNAQARVLDRAIPEDLVKRLAKPVIHRPQMLPANRETSRTSVPSASTLQLPEGGQHRASRKESPSPK
Ga0314725_1029215Ga0314725_10292151F035610MHESTIYLITLLELFVHIDREKHSLRVLTPRETTND
Ga0314725_1030062Ga0314725_10300621F068339SYLTTVVDESSAVAAGPLTMVADKLLAVEPMHNIYGCLPDTAEPVFDAELLAVVDVELLTMVADRSSAADLMHNIDNCQSEPMFDADKPSAVRCDNQTNEQFYKRPHL
Ga0314725_1030473Ga0314725_10304731F000459VPVRSGVLKHVDKVKRPKLTWDESVKRDLKDWDISEEVGLDRSAWRLVINVPES
Ga0314725_1030554Ga0314725_10305541F096451TFKDLYLYSCSVNLKKIMIIITFXNTVLDATIMHHIISCQWSMHGIASSSGIRRLLNGNASEYNIVGGLQFPLTYLPVTGTIGWLLLISLVVVFSHVTLMPRRNLDSRVRCSHMIELLGARWCLGMCDVTHCNLLLCNLTSVLTSDPYSSV
Ga0314725_1030766Ga0314725_10307661F053757MASRSGTRASHNRTLAAADAGVQPNGQNPPQEEHEVSQNGGENQEVPLPPPPPLGDLSQIIHNQTLILETLANALVNKRPREQTMNDKLTAFLRTKPPTFAGSSNPLDTNDWLCVIQRKLETFECQD
Ga0314725_1030896Ga0314725_10308961F104115GHKATYLVNGDDCLVSSDAYVSAESYPSGWKLNDKKTIRSEVVAEVNSTAFLSGGGKWREVRHLRRGGFQTDFKGMLHIASAVRASREWTDAFVHSRIGKKWGFLPSQLSLHPKSYPAFSRGREMWHRCYTPLPLAPSQVRSEGILGLRRALDPDERMAFTARQWSHGRDGGRKRDVYSPSVGEVRRTYAYKVVKPWSRLSFVSKLKSLKFDGYAY
Ga0314725_1032562Ga0314725_10325621F014470DVFSPSCGKVRRSYHYRVRPGISYLSFVGPGKTKLSPLWEKGADWGLVPADFRSEEEERGLAKLEQFRADWDSGFIAIGD
Ga0314725_1032636Ga0314725_10326361F096411QGGCSQGWEARKELESSHLGAQGCHHKYEEASNGVGSKGDMKPMIGFGGFGGLTHKLK
Ga0314725_1033315Ga0314725_10333151F067332MSPSIHVYCHIIMLANFGEDEIRRACIIISSCVEFWMVFVVPPILTRSLRAYIPILKFCAALLSVQLLAIQIIFPEKFDYEKDVRNYRFTYYRNFYDISEMFRWIPRLRLAL
Ga0314725_1033753Ga0314725_10337532F016911HYGYLVLKMPSPAGVLTVQGDRTAAVAAVERLHALAAEAARSEEDPSTSQPKAPAKAPKVQPSDPDHVPVKTVQIGADSTRTTRIAGNLEEK
Ga0314725_1034431Ga0314725_10344311F000255MGRIGCIRCEKSQREFAARTFALIALVHPVLHRVSCSYETIPNAPKHYETHQNMSLGSNGVEQVCSLRKITT
Ga0314725_1035085Ga0314725_10350851F026180SGATVQGGSKKKKNAHGNRPHPQGGNGGSCLIHPTARHSATDCREIQKLVRRVSGRREQSSNDGSPPPRQRSGNEKASDSETAVGEKELGYQSPAQELKGVYSHDNSGSDNEERRKKLYVMYGGSWELVSRRDVKTLRREVLSVRPGVPKAAPHHRWMNTTISFEPSDCPENLAGAGVLPLVTAPVIANIRLYHVLIDGG
Ga0314725_1036930Ga0314725_10369301F014095CKICEMLHSLDCFVDPVSSGLIRILPDSTAGLLRFKCVLTLVAVSVMVSALKPD
Ga0314725_1037115Ga0314725_10371151F014095MLHSLDCFVDPVSSGLIGSLPDSTAGLLRFKCVLTLIVVL
Ga0314725_1037705Ga0314725_10377051F012944LGSTRTQIDLKLISTWIGTPLAQPLFGLRNSSSTYKQMIRSIYENSLDHLLCGKNHSVTASREAPIFDIYPDPVESSQDSLDFITNALVKIQLESCESHTLAELLDNLRKVASIDDLPFQHSTPLVTERETRSGGTILADYESDMESFSPERLVPVIIQQPGGAPSQHDPNEALDQISEDNLTLDAPQDEDE
Ga0314725_1038742Ga0314725_10387422F084981SSSGAAHLAPDTQQCPYGTLRARPLGPRLYELLLLLWTCEAPVAGDLLASSVQCDARSLVKTLLLGTSAECGQNVVESVTPVCPAPATAQTALSLSLNLHLTLQLKLTGLTLLLPLSWLWWPWHL
Ga0314725_1039545Ga0314725_10395451F038940MNSDIFTANYGVKQSQFTKPTPEPRASDASDPEESNEPFDPASRGWLL
Ga0314725_1041865Ga0314725_10418651F067332MPPSIHVYCHIIMLANFGEDEIRRACIIISSCVEFWVVFLVHPILTRSLRAYIAVLKFCAALLSIQLLAIQIIFLEKFDYEKDMRNYRFTYYRNFNDLRGMFIWISRLNLALDPV
Ga0314725_1043412Ga0314725_10434121F020484MAKTLDAARSEIRNRLQRWDKMDITLLFGINFERIKTRWKEKFVHFAMEQCFSTGSVLKIERKIHEDEVAMGQRGIEGGDDDVK
Ga0314725_1044605Ga0314725_10446051F076725CLCVKVKLRTSILGVFTFLTPAGTSTLVATTKICIELLDCRTDPDPLAAGEGSGPLRTYSGERELVSRGGPEPV
Ga0314725_1045059Ga0314725_10450591F032517SSFDKIINPYSEFLGLYGGGADDLVERRGGGGIPSVNLMEELLGSLIPPRSNMSLLGAGLSSSMLRGDSETECLREELADASDVDERVLLLPAMNFMRPLMVTPCCTHSKTNTPGVSCRRENNISKSGAN
Ga0314725_1045514Ga0314725_10455141F000459RGRGRPKLTWDESVKRDLKDWNISKEIVLDRSAWRVAINVPEP
Ga0314725_1045658Ga0314725_10456581F037522LSRGPVLHPNLPVDRVTRMKFHMAQDSYDPLFVVNIVVWVLVVILAIVALHCPLPRRVVW

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.