Basic Information | |
---|---|
Family ID | F032670 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 179 |
Average Sequence Length | 47 residues |
Representative Sequence | MKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH |
Number of Associated Samples | 147 |
Number of Associated Scaffolds | 179 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Archaea |
% of genes with valid RBS motifs | 5.59 % |
% of genes near scaffold ends (potentially truncated) | 37.99 % |
% of genes from short scaffolds (< 2000 bps) | 68.16 % |
Associated GOLD sequencing projects | 135 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Archaea (94.413 % of family members) |
NCBI Taxonomy ID | 2157 |
Taxonomy | All Organisms → cellular organisms → Archaea |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment (12.849 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.285 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.872 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.91% β-sheet: 21.74% Coil/Unstructured: 54.35% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 179 Family Scaffolds |
---|---|---|
PF14947 | HTH_45 | 34.64 |
PF13894 | zf-C2H2_4 | 8.38 |
PF00149 | Metallophos | 5.59 |
PF02511 | Thy1 | 3.35 |
PF14008 | Metallophos_C | 2.23 |
PF05378 | Hydant_A_N | 1.68 |
PF12838 | Fer4_7 | 1.68 |
PF00994 | MoCF_biosynth | 1.12 |
PF06508 | QueC | 1.12 |
PF03835 | Rad4 | 0.56 |
PF00867 | XPG_I | 0.56 |
PF01094 | ANF_receptor | 0.56 |
PF07934 | OGG_N | 0.56 |
PF03951 | Gln-synt_N | 0.56 |
PF13401 | AAA_22 | 0.56 |
PF01661 | Macro | 0.56 |
PF02518 | HATPase_c | 0.56 |
COG ID | Name | Functional Category | % Frequency in 179 Family Scaffolds |
---|---|---|---|
COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 3.35 |
COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 3.35 |
COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 1.12 |
COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 1.12 |
COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 1.12 |
COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 1.12 |
COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 1.12 |
COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 1.12 |
COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 1.12 |
COG0780 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily | Translation, ribosomal structure and biogenesis [J] | 1.12 |
COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 1.12 |
COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 0.56 |
COG0174 | Glutamine synthetase | Amino acid transport and metabolism [E] | 0.56 |
COG0683 | ABC-type branched-chain amino acid transport system, periplasmic component | Amino acid transport and metabolism [E] | 0.56 |
COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 0.56 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.53 % |
Unclassified | root | N/A | 4.47 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090015|GPICI_9151165 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 14456 | Open in IMG/M |
2140918002|contig03161 | All Organisms → cellular organisms → Archaea | 1753 | Open in IMG/M |
2140918002|contig06715 | All Organisms → cellular organisms → Archaea | 2440 | Open in IMG/M |
3300000043|ARcpr5yngRDRAFT_c023253 | All Organisms → cellular organisms → Archaea | 529 | Open in IMG/M |
3300000044|ARSoilOldRDRAFT_c010875 | All Organisms → cellular organisms → Archaea | 763 | Open in IMG/M |
3300000559|F14TC_100207762 | All Organisms → cellular organisms → Archaea | 1863 | Open in IMG/M |
3300000559|F14TC_103829652 | All Organisms → cellular organisms → Archaea | 580 | Open in IMG/M |
3300000858|JGI10213J12805_10130976 | All Organisms → cellular organisms → Archaea | 696 | Open in IMG/M |
3300000891|JGI10214J12806_11950721 | All Organisms → cellular organisms → Archaea | 3938 | Open in IMG/M |
3300001431|F14TB_100238410 | All Organisms → cellular organisms → Archaea | 1018 | Open in IMG/M |
3300002090|JGI24806J26614_1015932 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 889 | Open in IMG/M |
3300002099|JGI24808J26613_1057836 | Not Available | 511 | Open in IMG/M |
3300002126|JGI24035J26624_1032054 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 575 | Open in IMG/M |
3300003267|soilL1_10008294 | All Organisms → cellular organisms → Archaea | 29879 | Open in IMG/M |
3300003316|rootH1_10186968 | All Organisms → cellular organisms → Archaea | 1194 | Open in IMG/M |
3300003319|soilL2_10063600 | All Organisms → cellular organisms → Archaea | 2993 | Open in IMG/M |
3300003319|soilL2_10145324 | All Organisms → cellular organisms → Archaea | 1823 | Open in IMG/M |
3300003382|JGI26139J50223_100002 | All Organisms → cellular organisms → Archaea | 14928 | Open in IMG/M |
3300003987|Ga0055471_10208580 | Not Available | 612 | Open in IMG/M |
3300004157|Ga0062590_102473450 | All Organisms → cellular organisms → Archaea | 549 | Open in IMG/M |
3300004463|Ga0063356_102662258 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 769 | Open in IMG/M |
3300004463|Ga0063356_104060943 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 630 | Open in IMG/M |
3300004479|Ga0062595_100227852 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 1184 | Open in IMG/M |
3300005159|Ga0066808_1001574 | All Organisms → cellular organisms → Archaea | 1686 | Open in IMG/M |
3300005161|Ga0066807_1006819 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 999 | Open in IMG/M |
3300005168|Ga0066809_10007129 | All Organisms → cellular organisms → Archaea | 2011 | Open in IMG/M |
3300005169|Ga0066810_10000414 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 3817 | Open in IMG/M |
3300005186|Ga0066676_10001134 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 10542 | Open in IMG/M |
3300005186|Ga0066676_10049113 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 2389 | Open in IMG/M |
3300005186|Ga0066676_10560504 | All Organisms → cellular organisms → Archaea | 774 | Open in IMG/M |
3300005269|Ga0065706_1000138 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 5475 | Open in IMG/M |
3300005276|Ga0065717_1000445 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 1262 | Open in IMG/M |
3300005289|Ga0065704_10006289 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 5316 | Open in IMG/M |
3300005289|Ga0065704_10815532 | All Organisms → cellular organisms → Archaea | 520 | Open in IMG/M |
3300005294|Ga0065705_10000039 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 8854 | Open in IMG/M |
3300005294|Ga0065705_10000146 | All Organisms → cellular organisms → Archaea | 13349 | Open in IMG/M |
3300005294|Ga0065705_10463758 | All Organisms → cellular organisms → Archaea | 793 | Open in IMG/M |
3300005334|Ga0068869_102035454 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 515 | Open in IMG/M |
3300005338|Ga0068868_100023412 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 4674 | Open in IMG/M |
3300005353|Ga0070669_100007901 | All Organisms → cellular organisms → Archaea | 7602 | Open in IMG/M |
3300005353|Ga0070669_101174251 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 662 | Open in IMG/M |
3300005441|Ga0070700_100690138 | All Organisms → cellular organisms → Archaea | 810 | Open in IMG/M |
3300005446|Ga0066686_10029409 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 3188 | Open in IMG/M |
3300005446|Ga0066686_10148400 | All Organisms → cellular organisms → Archaea | 1548 | Open in IMG/M |
3300005446|Ga0066686_10909030 | All Organisms → cellular organisms → Archaea | 577 | Open in IMG/M |
3300005456|Ga0070678_100823843 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 844 | Open in IMG/M |
3300005459|Ga0068867_100215806 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 1543 | Open in IMG/M |
3300005543|Ga0070672_100230925 | All Organisms → cellular organisms → Archaea | 1554 | Open in IMG/M |
3300005546|Ga0070696_100746444 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 801 | Open in IMG/M |
3300005615|Ga0070702_100101417 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera | 1766 | Open in IMG/M |
3300005844|Ga0068862_100265097 | All Organisms → cellular organisms → Archaea | 1569 | Open in IMG/M |
3300006049|Ga0075417_10022476 | All Organisms → cellular organisms → Archaea | 2529 | Open in IMG/M |
3300006358|Ga0068871_100177409 | All Organisms → cellular organisms → Archaea | 1829 | Open in IMG/M |
3300006845|Ga0075421_100725322 | All Organisms → cellular organisms → Archaea | 1152 | Open in IMG/M |
3300006845|Ga0075421_101937682 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 630 | Open in IMG/M |
3300006846|Ga0075430_100113683 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → unclassified Thaumarchaeota → Thaumarchaeota archaeon | 2256 | Open in IMG/M |
3300006876|Ga0079217_10001431 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 6459 | Open in IMG/M |
3300006894|Ga0079215_10002125 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 5178 | Open in IMG/M |
3300009012|Ga0066710_100042579 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 5501 | Open in IMG/M |
3300009094|Ga0111539_10010290 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 11776 | Open in IMG/M |
3300009094|Ga0111539_11393734 | All Organisms → cellular organisms → Archaea | 813 | Open in IMG/M |
3300009553|Ga0105249_12869985 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 553 | Open in IMG/M |
3300009553|Ga0105249_13394331 | All Organisms → cellular organisms → Archaea | 513 | Open in IMG/M |
3300009795|Ga0105059_1000075 | All Organisms → cellular organisms → Archaea | 8532 | Open in IMG/M |
3300009799|Ga0105075_1004797 | All Organisms → cellular organisms → Archaea | 1102 | Open in IMG/M |
3300009800|Ga0105069_1000638 | All Organisms → cellular organisms → Archaea | 1980 | Open in IMG/M |
3300009808|Ga0105071_1082968 | Not Available | 562 | Open in IMG/M |
3300009814|Ga0105082_1000380 | All Organisms → cellular organisms → Archaea | 4154 | Open in IMG/M |
3300009816|Ga0105076_1000058 | All Organisms → cellular organisms → Archaea | 7427 | Open in IMG/M |
3300009817|Ga0105062_1124037 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 525 | Open in IMG/M |
3300009822|Ga0105066_1166543 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 511 | Open in IMG/M |
3300010301|Ga0134070_10440226 | Not Available | 520 | Open in IMG/M |
3300010336|Ga0134071_10005675 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 4776 | Open in IMG/M |
3300010396|Ga0134126_12794534 | All Organisms → cellular organisms → Archaea | 529 | Open in IMG/M |
3300010397|Ga0134124_12169117 | All Organisms → cellular organisms → Archaea | 595 | Open in IMG/M |
3300012081|Ga0154003_1065983 | All Organisms → cellular organisms → Archaea | 619 | Open in IMG/M |
3300012201|Ga0137365_10000288 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 32007 | Open in IMG/M |
3300012360|Ga0137375_11379283 | All Organisms → cellular organisms → Archaea | 526 | Open in IMG/M |
3300012478|Ga0157328_1000511 | All Organisms → cellular organisms → Archaea | 1438 | Open in IMG/M |
3300012489|Ga0157349_1000112 | All Organisms → cellular organisms → Archaea | 3483 | Open in IMG/M |
3300012900|Ga0157292_10387876 | Not Available | 526 | Open in IMG/M |
3300012976|Ga0134076_10054168 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus → Candidatus Nitrosocosmicus oleophilus | 1519 | Open in IMG/M |
3300013308|Ga0157375_12505673 | All Organisms → cellular organisms → Archaea | 616 | Open in IMG/M |
3300013308|Ga0157375_12797590 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 583 | Open in IMG/M |
3300014265|Ga0075314_1004106 | All Organisms → cellular organisms → Archaea | 2583 | Open in IMG/M |
3300014326|Ga0157380_10507154 | All Organisms → cellular organisms → Archaea | 1173 | Open in IMG/M |
3300015373|Ga0132257_101197416 | All Organisms → cellular organisms → Archaea | 961 | Open in IMG/M |
3300017656|Ga0134112_10144815 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 911 | Open in IMG/M |
3300017792|Ga0163161_11980571 | Not Available | 518 | Open in IMG/M |
3300017997|Ga0184610_1011943 | All Organisms → cellular organisms → Archaea | 2198 | Open in IMG/M |
3300017997|Ga0184610_1015923 | All Organisms → cellular organisms → Archaea | 1967 | Open in IMG/M |
3300018000|Ga0184604_10215641 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 664 | Open in IMG/M |
3300018027|Ga0184605_10102476 | All Organisms → cellular organisms → Archaea | 1264 | Open in IMG/M |
3300018027|Ga0184605_10470101 | All Organisms → cellular organisms → Archaea | 551 | Open in IMG/M |
3300018028|Ga0184608_10138794 | All Organisms → cellular organisms → Archaea | 1041 | Open in IMG/M |
3300018028|Ga0184608_10457555 | Not Available | 549 | Open in IMG/M |
3300018031|Ga0184634_10009646 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 3401 | Open in IMG/M |
3300018031|Ga0184634_10039944 | All Organisms → cellular organisms → Archaea | 1899 | Open in IMG/M |
3300018051|Ga0184620_10022775 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 1575 | Open in IMG/M |
3300018051|Ga0184620_10350664 | All Organisms → cellular organisms → Archaea | 501 | Open in IMG/M |
3300018052|Ga0184638_1000368 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 12437 | Open in IMG/M |
3300018053|Ga0184626_10001104 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 9208 | Open in IMG/M |
3300018053|Ga0184626_10002319 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 6925 | Open in IMG/M |
3300018054|Ga0184621_10016744 | All Organisms → cellular organisms → Archaea | 2200 | Open in IMG/M |
3300018054|Ga0184621_10223625 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 674 | Open in IMG/M |
3300018056|Ga0184623_10000097 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 33726 | Open in IMG/M |
3300018061|Ga0184619_10059230 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 1677 | Open in IMG/M |
3300018063|Ga0184637_10009891 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 5729 | Open in IMG/M |
3300018075|Ga0184632_10003133 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 6894 | Open in IMG/M |
3300018077|Ga0184633_10138299 | All Organisms → Viruses → Predicted Viral | 1262 | Open in IMG/M |
3300018081|Ga0184625_10640797 | All Organisms → cellular organisms → Archaea | 516 | Open in IMG/M |
3300018084|Ga0184629_10216697 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 993 | Open in IMG/M |
3300018465|Ga0190269_10571891 | All Organisms → cellular organisms → Archaea | 755 | Open in IMG/M |
3300018465|Ga0190269_10884407 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 657 | Open in IMG/M |
3300018466|Ga0190268_10023002 | All Organisms → cellular organisms → Archaea | 2069 | Open in IMG/M |
3300018466|Ga0190268_10067056 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 1515 | Open in IMG/M |
3300018466|Ga0190268_11129731 | All Organisms → cellular organisms → Archaea | 641 | Open in IMG/M |
3300018920|Ga0190273_10195171 | All Organisms → cellular organisms → Archaea | 1261 | Open in IMG/M |
3300019878|Ga0193715_1000161 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 17818 | Open in IMG/M |
3300019884|Ga0193741_1000003 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 81213 | Open in IMG/M |
3300020003|Ga0193739_1004707 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 3675 | Open in IMG/M |
3300020018|Ga0193721_1114424 | Not Available | 682 | Open in IMG/M |
3300021078|Ga0210381_10055541 | All Organisms → cellular organisms → Archaea | 1199 | Open in IMG/M |
3300021972|Ga0193737_1000003 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 65917 | Open in IMG/M |
3300021972|Ga0193737_1016442 | All Organisms → cellular organisms → Archaea | 1024 | Open in IMG/M |
3300022694|Ga0222623_10368612 | All Organisms → cellular organisms → Archaea | 547 | Open in IMG/M |
3300023071|Ga0247752_1009656 | All Organisms → cellular organisms → Archaea | 1306 | Open in IMG/M |
3300025290|Ga0207673_1007877 | All Organisms → cellular organisms → Archaea | 1342 | Open in IMG/M |
3300025312|Ga0209321_10115449 | All Organisms → cellular organisms → Archaea | 1469 | Open in IMG/M |
3300025314|Ga0209323_10527327 | All Organisms → cellular organisms → Archaea | 682 | Open in IMG/M |
3300025315|Ga0207697_10000213 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 30994 | Open in IMG/M |
3300025318|Ga0209519_10555732 | All Organisms → cellular organisms → Archaea | 637 | Open in IMG/M |
3300025319|Ga0209520_10371463 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 863 | Open in IMG/M |
3300025904|Ga0207647_10253871 | All Organisms → cellular organisms → Archaea | 1008 | Open in IMG/M |
3300025908|Ga0207643_10000301 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 34169 | Open in IMG/M |
3300025908|Ga0207643_10002067 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 11070 | Open in IMG/M |
3300025914|Ga0207671_10113622 | All Organisms → cellular organisms → Archaea | 2063 | Open in IMG/M |
3300025926|Ga0207659_10803184 | All Organisms → cellular organisms → Archaea | 808 | Open in IMG/M |
3300025926|Ga0207659_11193338 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 654 | Open in IMG/M |
3300025934|Ga0207686_11158558 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 632 | Open in IMG/M |
3300025940|Ga0207691_10069798 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 3173 | Open in IMG/M |
3300025945|Ga0207679_11963774 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 533 | Open in IMG/M |
3300025972|Ga0207668_11185743 | All Organisms → cellular organisms → Archaea | 686 | Open in IMG/M |
3300026023|Ga0207677_11734879 | All Organisms → cellular organisms → Archaea | 579 | Open in IMG/M |
3300026041|Ga0207639_11382872 | All Organisms → cellular organisms → Archaea | 661 | Open in IMG/M |
3300026045|Ga0208535_1003911 | All Organisms → cellular organisms → Archaea | 1535 | Open in IMG/M |
3300026324|Ga0209470_1004447 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 9359 | Open in IMG/M |
3300026324|Ga0209470_1053458 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus | 1937 | Open in IMG/M |
3300026324|Ga0209470_1064712 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus | 1715 | Open in IMG/M |
3300026536|Ga0209058_1009046 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis | 7273 | Open in IMG/M |
3300026750|Ga0207483_101851 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 837 | Open in IMG/M |
3300026753|Ga0207528_102474 | All Organisms → cellular organisms → Archaea | 651 | Open in IMG/M |
3300026782|Ga0207595_100203 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus | 1392 | Open in IMG/M |
3300026818|Ga0207634_103227 | All Organisms → cellular organisms → Archaea | 635 | Open in IMG/M |
3300026841|Ga0207490_1006111 | All Organisms → cellular organisms → Archaea | 607 | Open in IMG/M |
3300026888|Ga0209900_1006227 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 876 | Open in IMG/M |
3300027006|Ga0209896_1000053 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 8720 | Open in IMG/M |
3300027013|Ga0209884_1000009 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 38772 | Open in IMG/M |
3300027032|Ga0209877_1029573 | All Organisms → cellular organisms → Archaea | 546 | Open in IMG/M |
3300027041|Ga0209876_1015785 | All Organisms → cellular organisms → Archaea | 592 | Open in IMG/M |
3300027209|Ga0209875_1000436 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus | 5806 | Open in IMG/M |
3300027252|Ga0209973_1004183 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus | 1467 | Open in IMG/M |
3300027428|Ga0207617_101855 | All Organisms → cellular organisms → Archaea | 842 | Open in IMG/M |
3300027523|Ga0208890_1068164 | All Organisms → cellular organisms → Archaea | 578 | Open in IMG/M |
3300027526|Ga0209968_1103041 | All Organisms → cellular organisms → Archaea | 521 | Open in IMG/M |
3300027560|Ga0207981_1007981 | All Organisms → cellular organisms → Archaea | 1877 | Open in IMG/M |
3300027637|Ga0209818_1000491 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae | 8797 | Open in IMG/M |
3300027637|Ga0209818_1007124 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 2192 | Open in IMG/M |
3300027639|Ga0209387_1249806 | All Organisms → cellular organisms → Archaea | 505 | Open in IMG/M |
3300027948|Ga0209858_1000325 | All Organisms → cellular organisms → Archaea | 3019 | Open in IMG/M |
3300028711|Ga0307293_10051452 | All Organisms → Viruses → Predicted Viral | 1280 | Open in IMG/M |
3300028718|Ga0307307_10038003 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus | 1386 | Open in IMG/M |
3300028755|Ga0307316_10266558 | All Organisms → cellular organisms → Archaea | 624 | Open in IMG/M |
3300028878|Ga0307278_10147493 | All Organisms → cellular organisms → Archaea | 1054 | Open in IMG/M |
3300031099|Ga0308181_1079142 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp. | 677 | Open in IMG/M |
3300031538|Ga0310888_10252016 | All Organisms → cellular organisms → Archaea | 991 | Open in IMG/M |
3300031716|Ga0310813_12187658 | All Organisms → cellular organisms → Archaea | 523 | Open in IMG/M |
3300031940|Ga0310901_10157397 | All Organisms → cellular organisms → Archaea | 875 | Open in IMG/M |
3300032180|Ga0307471_100587002 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus | 1272 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 12.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.61% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 8.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.26% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.70% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.47% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.35% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.35% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.79% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.79% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.23% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.23% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.23% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.12% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.12% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.12% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.12% |
Rhizosphere And Bulk Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Rhizosphere And Bulk Soil | 1.12% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.12% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.12% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.12% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.12% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.68% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.68% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.68% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.68% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.68% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.56% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.56% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.56% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.56% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.56% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.56% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.56% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.56% |
Sugarcane Root And Bulk Soil | Host-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil | 0.56% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.56% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.56% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.56% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.56% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.56% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
2140918002 | Rhizosphere and bulk soil microbial communities from the Great Lakes - Sample MSB1 | Environmental | Open in IMG/M |
3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Host-Associated | Open in IMG/M |
3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil old | Host-Associated | Open in IMG/M |
3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300002090 | Soil microbial communities from Manhattan, Kansas, USA - Sample 200um MDA | Environmental | Open in IMG/M |
3300002099 | Soil microbial communities from Manhattan, Kansas, USA - Sample 400um MDA | Environmental | Open in IMG/M |
3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Host-Associated | Open in IMG/M |
3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
3300003316 | Sugarcane root Sample L1 | Host-Associated | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300003382 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM | Host-Associated | Open in IMG/M |
3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005159 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPB | Environmental | Open in IMG/M |
3300005161 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPA | Environmental | Open in IMG/M |
3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005269 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 Bulk Soil | Environmental | Open in IMG/M |
3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 | Host-Associated | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009795 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50 | Environmental | Open in IMG/M |
3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
3300009800 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40 | Environmental | Open in IMG/M |
3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
3300009814 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 | Environmental | Open in IMG/M |
3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300012081 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL087 MetaG | Host-Associated | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Host-Associated | Open in IMG/M |
3300012489 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610 | Environmental | Open in IMG/M |
3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014265 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019878 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2 | Environmental | Open in IMG/M |
3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
3300020003 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2 | Environmental | Open in IMG/M |
3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021972 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Host-Associated | Open in IMG/M |
3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
3300025314 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
3300025319 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1 | Environmental | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026045 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026750 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-B (SPAdes) | Environmental | Open in IMG/M |
3300026753 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A4a-12 (SPAdes) | Environmental | Open in IMG/M |
3300026782 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A2-12 (SPAdes) | Environmental | Open in IMG/M |
3300026818 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A2-11 (SPAdes) | Environmental | Open in IMG/M |
3300026841 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A3a-10 (SPAdes) | Environmental | Open in IMG/M |
3300026888 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_10_20 (SPAdes) | Environmental | Open in IMG/M |
3300027006 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027013 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027032 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 (SPAdes) | Environmental | Open in IMG/M |
3300027041 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027428 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A2-11 (SPAdes) | Environmental | Open in IMG/M |
3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027560 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes) | Environmental | Open in IMG/M |
3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027639 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes) | Environmental | Open in IMG/M |
3300027948 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 (SPAdes) | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300031099 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPICI_02244860 | 2088090015 | Soil | MKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH |
MSB1_00009120 | 2140918002 | Rhizosphere And Bulk Soil | MKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDNDLISSYEKH |
MSB1_00092090 | 2140918002 | Rhizosphere And Bulk Soil | MKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLLSFYEKH |
ARcpr5yngRDRAFT_0232531 | 3300000043 | Arabidopsis Rhizosphere | IKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH* |
ARSoilOldRDRAFT_0108751 | 3300000044 | Arabidopsis Rhizosphere | KCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH* |
F14TC_1002077622 | 3300000559 | Soil | MKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH* |
F14TC_1038296522 | 3300000559 | Soil | MKCGICKEEIIKEKRREHLKHHKLDDTLVEWIIETDNDLISSYEKY* |
JGI10213J12805_101309761 | 3300000858 | Soil | MKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISFYERH* |
JGI10214J12806_119507218 | 3300000891 | Soil | MLNGSLPLSQPNLFMKCGICKEEIIKDKRREHLRYHKLDDTLAEWIIETDDDLISENRN* |
F14TB_1002384102 | 3300001431 | Soil | MKCGICKQEIIKEKRREHLKYHKLDDTLVEWIIETDNDLISSYEKY* |
JGI24806J26614_10159322 | 3300002090 | Soil | MKCGICKEEIIKEKRREHLKYHKLDDTLVQWIIETDNDLISSYEKH* |
JGI24808J26613_10578361 | 3300002099 | Soil | MKCGICKEEIIKDKRRAHLKHHKLDDTLVEWIIETDNDLISSYEKY* |
JGI24035J26624_10320542 | 3300002126 | Corn, Switchgrass And Miscanthus Rhizosphere | MKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEXH* |
soilL1_1000829430 | 3300003267 | Sugarcane Root And Bulk Soil | MKCGICKEEIIKDKRREHLRYHKLDDTLVEWIIETDDDLISLYEK* |
rootH1_101869683 | 3300003316 | Sugarcane Root And Bulk Soil | NLFMKCGICKEEIIKDKRREHLRYHKLDDTLAEWIIETDDNLISTNNRN* |
soilL2_100636005 | 3300003319 | Sugarcane Root And Bulk Soil | MKCGICKEEIIKDKRREHLRYHKLDDTLVEWIIETDDDLISTKNRV* |
soilL2_101453244 | 3300003319 | Sugarcane Root And Bulk Soil | MKCGICKEEIIKHKRREHLRYHKLDDTLVEWIIETDDDLISLYEK* |
JGI26139J50223_10000214 | 3300003382 | Arabidopsis Thaliana Rhizosphere | VIYILKLYLDLPLPNLFMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH* |
Ga0055471_102085802 | 3300003987 | Natural And Restored Wetlands | MKCGICKEEIIREKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH* |
Ga0062590_1024734501 | 3300004157 | Soil | QPNLFMKCGICKEEIIKDKRREHLRYHKLDDTLAEWIIETDDDLISENRN* |
Ga0063356_1026622581 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH* |
Ga0063356_1040609431 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKCGICKEEIIKDKRREHLRYHKLDDTLAEWIIETDDDLISENRN* |
Ga0062595_1002278522 | 3300004479 | Soil | MKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH* |
Ga0066808_10015743 | 3300005159 | Soil | TLTLPVPNLFMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH* |
Ga0066807_10068193 | 3300005161 | Soil | VPNLFMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH* |
Ga0066809_100071293 | 3300005168 | Soil | MKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH* |
Ga0066810_100004142 | 3300005169 | Soil | LTLPVPNLFMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH* |
Ga0066676_100011342 | 3300005186 | Soil | MKCGICKEEILREKRREHLKYHKLDETLVDWIIETDDDLISFFEKH* |
Ga0066676_100491133 | 3300005186 | Soil | MKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLKSFYEKH* |
Ga0066676_105605041 | 3300005186 | Soil | MKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYKKH* |
Ga0065706_10001384 | 3300005269 | Switchgrass Rhizosphere | LTLPLPNHFMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDNDLISSYEKH* |
Ga0065717_10004453 | 3300005276 | Arabidopsis Rhizosphere | LTLPVPNLSMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH* |
Ga0065704_100062895 | 3300005289 | Switchgrass Rhizosphere | MKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDNDLISSYEKH* |
Ga0065704_108155321 | 3300005289 | Switchgrass Rhizosphere | TLPVPNLSMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH* |
Ga0065705_100000393 | 3300005294 | Switchgrass Rhizosphere | MKCGICKEEIIKEXRREHLKYHKLDDTLVEWIIETDDDLISFYEKH* |
Ga0065705_1000014621 | 3300005294 | Switchgrass Rhizosphere | MKCGICKEEIIKEKRREHLKYHKLDDTLVEWXIETDNDLISSYEKH* |
Ga0065705_104637581 | 3300005294 | Switchgrass Rhizosphere | YTLTLPVPNLFMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH* |
Ga0068869_1020354542 | 3300005334 | Miscanthus Rhizosphere | MKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLI |
Ga0068868_1000234123 | 3300005338 | Miscanthus Rhizosphere | LTLPPPNLFMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH* |
Ga0070669_10000790113 | 3300005353 | Switchgrass Rhizosphere | CGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH* |
Ga0070669_1011742511 | 3300005353 | Switchgrass Rhizosphere | MKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLIS |
Ga0070700_1006901381 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | FMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDNDLISSYEKH* |
Ga0066686_100294093 | 3300005446 | Soil | LTLPVPNLFMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYKKH* |
Ga0066686_101484004 | 3300005446 | Soil | LTLRVPNLFMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLKSFYEKH* |
Ga0066686_109090301 | 3300005446 | Soil | NLFMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH* |
Ga0070678_1008238432 | 3300005456 | Miscanthus Rhizosphere | VPNLSMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH* |
Ga0068867_1002158062 | 3300005459 | Miscanthus Rhizosphere | LTLPLPNLFMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH* |
Ga0070672_1002309251 | 3300005543 | Miscanthus Rhizosphere | KEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH* |
Ga0070696_1007464442 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISSYEKH* |
Ga0070702_1001014171 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFY |
Ga0068862_1002650971 | 3300005844 | Switchgrass Rhizosphere | EKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH* |
Ga0075417_100224763 | 3300006049 | Populus Rhizosphere | MKCGICKEEIIREKRREHLRFHKLDDTLVEWIIETDDDLISSYEKH* |
Ga0068871_1001774091 | 3300006358 | Miscanthus Rhizosphere | KEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH* |
Ga0075421_1007253223 | 3300006845 | Populus Rhizosphere | FMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH* |
Ga0075421_1019376821 | 3300006845 | Populus Rhizosphere | MKCGICKEEIIREKRREHLRFHKLDDTLVEWLIETDDDLISLYEKH* |
Ga0075430_1001136831 | 3300006846 | Populus Rhizosphere | MKCGICKEEIIREKRRQHLRYHKLDDTLVEWIIETDDDLISSYEKH* |
Ga0079217_100014317 | 3300006876 | Agricultural Soil | MKCGICKEEIIREKRREHLRFHKLDDTLVEWLIKTDDDLISIYEKH* |
Ga0079215_100021257 | 3300006894 | Agricultural Soil | MKCGICNEEIIREKRREHLRFHKLDDTLVEWLIETDDDLISLYEKH* |
Ga0066710_1000425791 | 3300009012 | Grasslands Soil | MKCGICKEEILREKRRKHLKYHKLDETLVEWIIETDDDLISFFEKH |
Ga0111539_1001029013 | 3300009094 | Populus Rhizosphere | VPNLSMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWII |
Ga0111539_113937341 | 3300009094 | Populus Rhizosphere | EEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH* |
Ga0105249_128699852 | 3300009553 | Switchgrass Rhizosphere | MKCGICKEEIIKEKRIEHLRYHKLDDTLVEWIIETDDDLISSYEK |
Ga0105249_133943311 | 3300009553 | Switchgrass Rhizosphere | ICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH* |
Ga0105059_10000756 | 3300009795 | Groundwater Sand | MKCGICKEEIIREKRREHLKYHRLDDTLVEWIIETDDHLISFYEKH* |
Ga0105075_10047971 | 3300009799 | Groundwater Sand | MKCGICKEDIIREKRREHLKYHRLDDTLVEWIIETDDHLISFYEKH* |
Ga0105069_10006383 | 3300009800 | Groundwater Sand | VPNLLMKCGICKEEIIREKRREHLKYHRLDDTLVEWIIETDDHLISFYEKH* |
Ga0105071_10829681 | 3300009808 | Groundwater Sand | VPNLFMKCGICKEEIIREKRREHLKYHKLDDTLVQWIIETDDDLISFYEKH* |
Ga0105082_10003804 | 3300009814 | Groundwater Sand | MKCGICKEEIIREKRREHLKYHRLDDTLVEWIIETDDDLISFYEKH* |
Ga0105076_10000583 | 3300009816 | Groundwater Sand | MKCGICKEEILREKRREHLKYHRLDDTLVEWIIETDDHLISFYEKH* |
Ga0105062_11240371 | 3300009817 | Groundwater Sand | MKCGICKEEIIREKRREHLKYHRLDDTLVEWIIETDDHLI |
Ga0105066_11665432 | 3300009822 | Groundwater Sand | MKCGICKEEIIREKRREHLKYHRLDDTLVEWIIETDD |
Ga0134070_104402261 | 3300010301 | Grasslands Soil | VPNLFMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYKKH* |
Ga0134071_100056757 | 3300010336 | Grasslands Soil | MKCGICKEEILREKRREHLKYHKLDETLVEWIIETDDDLISFFEKH* |
Ga0134126_127945341 | 3300010396 | Terrestrial Soil | IKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH* |
Ga0134124_121691171 | 3300010397 | Terrestrial Soil | KEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH* |
Ga0154003_10659831 | 3300012081 | Attine Ant Fungus Gardens | MKCGICKEEIIKDKRREHLRYHKLDDTLAEWIIETDDNLISTKNRN* |
Ga0137365_100002883 | 3300012201 | Vadose Zone Soil | MKCGICKEEILREKRRKHLKYHKLDETLVEWIIETDDDLISFFEKH* |
Ga0137375_113792831 | 3300012360 | Vadose Zone Soil | VPNLFMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISFFEKH* |
Ga0157328_10005111 | 3300012478 | Arabidopsis Rhizosphere | TLTLPVPNLSMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH* |
Ga0157349_10001121 | 3300012489 | Unplanted Soil | EIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH* |
Ga0157292_103878761 | 3300012900 | Soil | MKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDNDLISSYEKY* |
Ga0134076_100541683 | 3300012976 | Grasslands Soil | VPNLFMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLKSFYEKH* |
Ga0157375_125056731 | 3300013308 | Miscanthus Rhizosphere | KEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH* |
Ga0157375_127975902 | 3300013308 | Miscanthus Rhizosphere | VPNLSMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEK |
Ga0075314_10041063 | 3300014265 | Natural And Restored Wetlands | MKCGICKEEIIREKRREHLRFHKLDDTLVEWLIETDDDLTSPYEKH* |
Ga0157380_105071542 | 3300014326 | Switchgrass Rhizosphere | VPNLSMKCGICKEEIIKEKRRDHLKYHKLDDILVEWIIETDDDLISFYEKH* |
Ga0132257_1011974161 | 3300015373 | Arabidopsis Rhizosphere | EEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKY* |
Ga0134112_101448152 | 3300017656 | Grasslands Soil | VPNLFMKCGICKEEIIREKRREHLKYHKLDETLVDWIIETDDDLISFYEKH |
Ga0163161_119805712 | 3300017792 | Switchgrass Rhizosphere | MKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH |
Ga0184610_10119431 | 3300017997 | Groundwater Sediment | VPNLFMKCGICKEEIIREKRREHLKYHKLDDTLVQWIIETDDDLISFYEKH |
Ga0184610_10159232 | 3300017997 | Groundwater Sediment | MKCGICKQEIIKEKRRDHLRYHKLDDTLVEWIIETDDDLISSYEKN |
Ga0184604_102156411 | 3300018000 | Groundwater Sediment | MKCGICKEEIIREKRREHLKHHKLDDTLVKWIIETDDDLISFYEKH |
Ga0184605_101024762 | 3300018027 | Groundwater Sediment | MKCGICKQEIIKEKRRDHLRYHKLDDTLVEWIIETDDDLISSYEKH |
Ga0184605_104701011 | 3300018027 | Groundwater Sediment | MKCGICKEEILREKRREHLKYHKLDETLVEWIIETDDDLISFFEKH |
Ga0184608_101387941 | 3300018028 | Groundwater Sediment | MKCGICKEEIIKEKRREHLKYHKLDDTLVQWIIETDDDLISSYEKH |
Ga0184608_104575551 | 3300018028 | Groundwater Sediment | MKCGICKQEIIKEKRRDHLRYHKLDDTLVEWIIETDNDLISSYEKH |
Ga0184634_100096464 | 3300018031 | Groundwater Sediment | LTLPVANLFMKCGICKEEIIREKRREHLKYHKLDDTLVQWIIETDDDLISFYEKH |
Ga0184634_100399442 | 3300018031 | Groundwater Sediment | LTLPVPNLFMKCGICREEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH |
Ga0184620_100227753 | 3300018051 | Groundwater Sediment | VPNLFMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH |
Ga0184620_103506641 | 3300018051 | Groundwater Sediment | MKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISSYEKN |
Ga0184638_10003681 | 3300018052 | Groundwater Sediment | LTLPVPNLFMKCGICREEIIREKRREHLKHHKLDDTLVEWIIETDDDLISFYEKH |
Ga0184626_100011042 | 3300018053 | Groundwater Sediment | MKCGICKEEIIKEKRKEHLKYHKLDDTLVEWIIETDDDLISFYEKH |
Ga0184626_100023192 | 3300018053 | Groundwater Sediment | MKCGICKQEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISSYEKH |
Ga0184621_100167442 | 3300018054 | Groundwater Sediment | LPNLFMKCGICKQEIIKEKRRDHLRYHKLDDTLVEWIIETDDDLISSYEKH |
Ga0184621_102236251 | 3300018054 | Groundwater Sediment | MKCGICKQEIIKEKRRDHLRYHKLDDTLVEWIIETD |
Ga0184623_100000978 | 3300018056 | Groundwater Sediment | MKCGICKEEIIREKRREHLKYHKLDDTLVQWIIETDDDLISFYEKH |
Ga0184619_100592302 | 3300018061 | Groundwater Sediment | VPNLFMKCGICKEEIIREKRREHLKHHKLDDTLVKWIIETDDDLISFYEKH |
Ga0184637_100098915 | 3300018063 | Groundwater Sediment | MKCGICKQEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH |
Ga0184632_100031338 | 3300018075 | Groundwater Sediment | MKCGICREEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH |
Ga0184633_101382991 | 3300018077 | Groundwater Sediment | TLRVPNLFMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH |
Ga0184625_106407971 | 3300018081 | Groundwater Sediment | MKCGICKEEIIKEKRREHLKYHKLDDTLVQWIIETDDDLISYEKH |
Ga0184629_102166972 | 3300018084 | Groundwater Sediment | MKCGICKEEIIKEKSREHLKYHKLDDTLVEWIIETDDDLISSYEKN |
Ga0190269_105718911 | 3300018465 | Soil | MKCGICKEEIIREKRREHLRFHKLDDTLVEWLIETDDDLISLYEKH |
Ga0190269_108844072 | 3300018465 | Soil | VPNLLMKCGICKEEIIREKRREHLKYHRLDDTLVEWIIETDDHLISFYEKH |
Ga0190268_100230022 | 3300018466 | Soil | MKCGICKEEIIREKRREHLRFHKLDDTLVEWLIKTDDDLISIYEKH |
Ga0190268_100670561 | 3300018466 | Soil | MKCGICKEEIIREKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH |
Ga0190268_111297312 | 3300018466 | Soil | MKCGICKEELIREKRREHLRFHKLDDTLVEWLIETDDDLISLYEKH |
Ga0190273_101951712 | 3300018920 | Soil | MKCGICKEEIIREKRREHLRFHKLDDTLVEWLIETDDDLISLYDKH |
Ga0193715_100016115 | 3300019878 | Soil | MKCGICKQEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISSYEKH |
Ga0193741_100000348 | 3300019884 | Soil | MKCGICKEEIIREKRRGHLRFHKLDDTLVEWLIETDDDLISLYEKH |
Ga0193739_10047071 | 3300020003 | Soil | MKCGICKEEIIREKRREHLRYHKLGDTLVEWIIETDDDLISSYEKH |
Ga0193721_11144241 | 3300020018 | Soil | NYTLTLPVPNLFMKCGICKEEIIREKRREHLKHHKLDDTLVKWIIETDDDLISFYEKH |
Ga0210381_100555412 | 3300021078 | Groundwater Sediment | CTLTLSLPNLFMKCGICKQEIIKEKRRDHLRYHKLDDTLVEWIIETDNDLISSYEKH |
Ga0193737_100000342 | 3300021972 | Soil | MKCGICKEEIIREKRRVHLRFHKLDDTLVEWLIETDDDLISLYEKH |
Ga0193737_10164421 | 3300021972 | Soil | REKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH |
Ga0222623_103686121 | 3300022694 | Groundwater Sediment | IKEKRREHLKHHKLDDTLVKWIIETDDDLISFYEKH |
Ga0247752_10096562 | 3300023071 | Soil | KEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH |
Ga0207673_10078771 | 3300025290 | Corn, Switchgrass And Miscanthus Rhizosphere | MKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH |
Ga0209321_101154491 | 3300025312 | Soil | LTLQQPNLFMKCGICKEEIIREKRREHLRFHKLDDTLVEWLIETDDDLISLYEKH |
Ga0209323_105273271 | 3300025314 | Soil | SQPNLFMKCGICKEEIIREKRREHLRFHKLDDTLVEWLIETDDDLISLYEKH |
Ga0207697_1000021328 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | LTLPVPNLSMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH |
Ga0209519_105557321 | 3300025318 | Soil | LTLPQPNLFMKCGICKEEIIREKRREHLRFHKLDDTLVEWLIETDDDLISLYEKH |
Ga0209520_103714631 | 3300025319 | Soil | MKCGICKEEIIREKRREHLRFHKLDDTLVEWLIKTDDDLISLYEKH |
Ga0207647_102538711 | 3300025904 | Corn Rhizosphere | EIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH |
Ga0207643_100003017 | 3300025908 | Miscanthus Rhizosphere | MKCGICKEEIIKDKRREHLRYHKLDDTLAEWIIETDDDLISENRN |
Ga0207643_1000206712 | 3300025908 | Miscanthus Rhizosphere | MKGGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH |
Ga0207671_101136223 | 3300025914 | Corn Rhizosphere | VPNLSMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH |
Ga0207659_108031841 | 3300025926 | Miscanthus Rhizosphere | SMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH |
Ga0207659_111933381 | 3300025926 | Miscanthus Rhizosphere | MKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLI |
Ga0207686_111585581 | 3300025934 | Miscanthus Rhizosphere | MKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIET |
Ga0207691_100697981 | 3300025940 | Miscanthus Rhizosphere | MKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKP |
Ga0207679_119637741 | 3300025945 | Corn Rhizosphere | MKCGICKEKIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH |
Ga0207668_111857431 | 3300025972 | Switchgrass Rhizosphere | ICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKP |
Ga0207677_117348791 | 3300026023 | Miscanthus Rhizosphere | CGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH |
Ga0207639_113828721 | 3300026041 | Corn Rhizosphere | LTLPPPNLFMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH |
Ga0208535_10039111 | 3300026045 | Natural And Restored Wetlands | MKCGICKEEIIREKRREHLRFHKLDDTLVEWLIETDDDLTSPYEKH |
Ga0209470_100444710 | 3300026324 | Soil | MKCGICKEEILREKRREHLKYHKLDETLVDWIIETDDDLISFFEKH |
Ga0209470_10534583 | 3300026324 | Soil | VPNLFMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYKKH |
Ga0209470_10647123 | 3300026324 | Soil | MKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLKSFYEKH |
Ga0209058_10090467 | 3300026536 | Soil | MKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYKKH |
Ga0207483_1018511 | 3300026750 | Soil | MKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIET |
Ga0207528_1024741 | 3300026753 | Soil | MKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISSYEKH |
Ga0207595_1002033 | 3300026782 | Soil | MKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSY |
Ga0207634_1032271 | 3300026818 | Soil | PNLFMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH |
Ga0207490_10061111 | 3300026841 | Soil | TLPLPNLFMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH |
Ga0209900_10062273 | 3300026888 | Groundwater Sand | MKCGICKEDIIREKRREHLKYHRLDDTLVEWIIETDDHLISFY |
Ga0209896_10000539 | 3300027006 | Groundwater Sand | MKCGICKEDIIREKRREHLKYHRLDDTLVEWIIETDDHLISFYEKH |
Ga0209884_100000939 | 3300027013 | Groundwater Sand | MKCGICKEEIIREKRREHLKYHRLDDTLVEWIIETDDHLISFYEKH |
Ga0209877_10295731 | 3300027032 | Groundwater Sand | EDIIREKRREHLKYHRLDDTLVEWIIETDDHLISFYEKH |
Ga0209876_10157851 | 3300027041 | Groundwater Sand | KIILLTLSVPNLFMKCGICKEDIIREKRREHLKYHRLDDTLVEWIIETDDHLISFYEKH |
Ga0209875_10004366 | 3300027209 | Groundwater Sand | MKCGICKEEILREKRREHLKYHRLDDTLVEWIIETDDHLISFYEKH |
Ga0209973_10041833 | 3300027252 | Arabidopsis Thaliana Rhizosphere | MKCGICKEEIIKDKRREHLRYHKLDDTLAEWIIETDDDL |
Ga0207617_1018551 | 3300027428 | Soil | CKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH |
Ga0208890_10681642 | 3300027523 | Soil | VPNLFMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH |
Ga0209968_11030412 | 3300027526 | Arabidopsis Thaliana Rhizosphere | LSQPNLFMKCGICKEEIIKDKRREHLRYHKLDDTLAEWIIETDDDLISENRN |
Ga0207981_10079811 | 3300027560 | Soil | EIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH |
Ga0209818_10004911 | 3300027637 | Agricultural Soil | IYMLKWYFDITTANLFMKCGICKEEIIREKRREHLRFHKLDDTLVEWLIKTDDDLISIYEKH |
Ga0209818_10071244 | 3300027637 | Agricultural Soil | MKCGICKEEIIREKRREHLRFHKLDDTLVEWLIKTDDDL |
Ga0209387_12498061 | 3300027639 | Agricultural Soil | PNLFMKCGICKEEIIREKRREHLRFHKLDDTLVEWLIETDDDLISLYEKH |
Ga0209858_10003255 | 3300027948 | Groundwater Sand | LTLPVPNLLMKCGICKEEIIREKRREHLKYHRLDDTLVEWIIETDDHLISFYEKH |
Ga0307293_100514522 | 3300028711 | Soil | LRVPNLFMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH |
Ga0307307_100380031 | 3300028718 | Soil | MKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISFYE |
Ga0307316_102665581 | 3300028755 | Soil | MKCGICKEEIIKEKRREHLKYNKLDDTLVEWIIETDDDLISFYEKH |
Ga0307278_101474931 | 3300028878 | Soil | RVPNLFMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH |
Ga0308181_10791422 | 3300031099 | Soil | VPNLFMKCGICKEEIIKEKRKEHLKYHKLDDTLVEWIIETDDDLISFYEKH |
Ga0310888_102520161 | 3300031538 | Soil | PVPNLSMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH |
Ga0310813_121876582 | 3300031716 | Soil | LPPPNLFMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH |
Ga0310901_101573971 | 3300031940 | Soil | LPLPNLFMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH |
Ga0307471_1005870021 | 3300032180 | Hardwood Forest Soil | MKCGICKEEIIKEKRREHLKYHRLDDTLVEWIIETDDDLISSYEKP |
⦗Top⦘ |