NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F032670

Metagenome / Metatranscriptome Family F032670

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F032670
Family Type Metagenome / Metatranscriptome
Number of Sequences 179
Average Sequence Length 47 residues
Representative Sequence MKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH
Number of Associated Samples 147
Number of Associated Scaffolds 179

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Archaea
% of genes with valid RBS motifs 5.59 %
% of genes near scaffold ends (potentially truncated) 37.99 %
% of genes from short scaffolds (< 2000 bps) 68.16 %
Associated GOLD sequencing projects 135
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Archaea (94.413 % of family members)
NCBI Taxonomy ID 2157
Taxonomy All Organisms → cellular organisms → Archaea

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment
(12.849 % of family members)
Environment Ontology (ENVO) Unclassified
(31.285 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(36.872 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.91%    β-sheet: 21.74%    Coil/Unstructured: 54.35%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 179 Family Scaffolds
PF14947HTH_45 34.64
PF13894zf-C2H2_4 8.38
PF00149Metallophos 5.59
PF02511Thy1 3.35
PF14008Metallophos_C 2.23
PF05378Hydant_A_N 1.68
PF12838Fer4_7 1.68
PF00994MoCF_biosynth 1.12
PF06508QueC 1.12
PF03835Rad4 0.56
PF00867XPG_I 0.56
PF01094ANF_receptor 0.56
PF07934OGG_N 0.56
PF03951Gln-synt_N 0.56
PF13401AAA_22 0.56
PF01661Macro 0.56
PF02518HATPase_c 0.56

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 179 Family Scaffolds
COG0145N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunitAmino acid transport and metabolism [E] 3.35
COG1351Thymidylate synthase ThyX, FAD-dependent familyNucleotide transport and metabolism [F] 3.35
COG0037tRNA(Ile)-lysidine synthase TilS/MesJTranslation, ribosomal structure and biogenesis [J] 1.12
COG0137Argininosuccinate synthaseAmino acid transport and metabolism [E] 1.12
COG0171NH3-dependent NAD+ synthetaseCoenzyme transport and metabolism [H] 1.12
COG0301Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis)Translation, ribosomal structure and biogenesis [J] 1.12
COG0482tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domainTranslation, ribosomal structure and biogenesis [J] 1.12
COG0519GMP synthase, PP-ATPase domain/subunitNucleotide transport and metabolism [F] 1.12
COG06037-cyano-7-deazaguanine synthase (queuosine biosynthesis)Translation, ribosomal structure and biogenesis [J] 1.12
COG0780NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamilyTranslation, ribosomal structure and biogenesis [J] 1.12
COG1606ATP-utilizing enzyme, PP-loop superfamilyGeneral function prediction only [R] 1.12
COG01223-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylaseReplication, recombination and repair [L] 0.56
COG0174Glutamine synthetaseAmino acid transport and metabolism [E] 0.56
COG0683ABC-type branched-chain amino acid transport system, periplasmic componentAmino acid transport and metabolism [E] 0.56
COG2110O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domainTranslation, ribosomal structure and biogenesis [J] 0.56


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.53 %
UnclassifiedrootN/A4.47 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090015|GPICI_9151165All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae14456Open in IMG/M
2140918002|contig03161All Organisms → cellular organisms → Archaea1753Open in IMG/M
2140918002|contig06715All Organisms → cellular organisms → Archaea2440Open in IMG/M
3300000043|ARcpr5yngRDRAFT_c023253All Organisms → cellular organisms → Archaea529Open in IMG/M
3300000044|ARSoilOldRDRAFT_c010875All Organisms → cellular organisms → Archaea763Open in IMG/M
3300000559|F14TC_100207762All Organisms → cellular organisms → Archaea1863Open in IMG/M
3300000559|F14TC_103829652All Organisms → cellular organisms → Archaea580Open in IMG/M
3300000858|JGI10213J12805_10130976All Organisms → cellular organisms → Archaea696Open in IMG/M
3300000891|JGI10214J12806_11950721All Organisms → cellular organisms → Archaea3938Open in IMG/M
3300001431|F14TB_100238410All Organisms → cellular organisms → Archaea1018Open in IMG/M
3300002090|JGI24806J26614_1015932All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera889Open in IMG/M
3300002099|JGI24808J26613_1057836Not Available511Open in IMG/M
3300002126|JGI24035J26624_1032054All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.575Open in IMG/M
3300003267|soilL1_10008294All Organisms → cellular organisms → Archaea29879Open in IMG/M
3300003316|rootH1_10186968All Organisms → cellular organisms → Archaea1194Open in IMG/M
3300003319|soilL2_10063600All Organisms → cellular organisms → Archaea2993Open in IMG/M
3300003319|soilL2_10145324All Organisms → cellular organisms → Archaea1823Open in IMG/M
3300003382|JGI26139J50223_100002All Organisms → cellular organisms → Archaea14928Open in IMG/M
3300003987|Ga0055471_10208580Not Available612Open in IMG/M
3300004157|Ga0062590_102473450All Organisms → cellular organisms → Archaea549Open in IMG/M
3300004463|Ga0063356_102662258All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.769Open in IMG/M
3300004463|Ga0063356_104060943All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.630Open in IMG/M
3300004479|Ga0062595_100227852All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.1184Open in IMG/M
3300005159|Ga0066808_1001574All Organisms → cellular organisms → Archaea1686Open in IMG/M
3300005161|Ga0066807_1006819All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.999Open in IMG/M
3300005168|Ga0066809_10007129All Organisms → cellular organisms → Archaea2011Open in IMG/M
3300005169|Ga0066810_10000414All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis3817Open in IMG/M
3300005186|Ga0066676_10001134All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis10542Open in IMG/M
3300005186|Ga0066676_10049113All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota2389Open in IMG/M
3300005186|Ga0066676_10560504All Organisms → cellular organisms → Archaea774Open in IMG/M
3300005269|Ga0065706_1000138All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis5475Open in IMG/M
3300005276|Ga0065717_1000445All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.1262Open in IMG/M
3300005289|Ga0065704_10006289All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae5316Open in IMG/M
3300005289|Ga0065704_10815532All Organisms → cellular organisms → Archaea520Open in IMG/M
3300005294|Ga0065705_10000039All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis8854Open in IMG/M
3300005294|Ga0065705_10000146All Organisms → cellular organisms → Archaea13349Open in IMG/M
3300005294|Ga0065705_10463758All Organisms → cellular organisms → Archaea793Open in IMG/M
3300005334|Ga0068869_102035454All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.515Open in IMG/M
3300005338|Ga0068868_100023412All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis4674Open in IMG/M
3300005353|Ga0070669_100007901All Organisms → cellular organisms → Archaea7602Open in IMG/M
3300005353|Ga0070669_101174251All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.662Open in IMG/M
3300005441|Ga0070700_100690138All Organisms → cellular organisms → Archaea810Open in IMG/M
3300005446|Ga0066686_10029409All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis3188Open in IMG/M
3300005446|Ga0066686_10148400All Organisms → cellular organisms → Archaea1548Open in IMG/M
3300005446|Ga0066686_10909030All Organisms → cellular organisms → Archaea577Open in IMG/M
3300005456|Ga0070678_100823843All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota844Open in IMG/M
3300005459|Ga0068867_100215806All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.1543Open in IMG/M
3300005543|Ga0070672_100230925All Organisms → cellular organisms → Archaea1554Open in IMG/M
3300005546|Ga0070696_100746444All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.801Open in IMG/M
3300005615|Ga0070702_100101417All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera1766Open in IMG/M
3300005844|Ga0068862_100265097All Organisms → cellular organisms → Archaea1569Open in IMG/M
3300006049|Ga0075417_10022476All Organisms → cellular organisms → Archaea2529Open in IMG/M
3300006358|Ga0068871_100177409All Organisms → cellular organisms → Archaea1829Open in IMG/M
3300006845|Ga0075421_100725322All Organisms → cellular organisms → Archaea1152Open in IMG/M
3300006845|Ga0075421_101937682All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.630Open in IMG/M
3300006846|Ga0075430_100113683All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → unclassified Thaumarchaeota → Thaumarchaeota archaeon2256Open in IMG/M
3300006876|Ga0079217_10001431All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis6459Open in IMG/M
3300006894|Ga0079215_10002125All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis5178Open in IMG/M
3300009012|Ga0066710_100042579All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis5501Open in IMG/M
3300009094|Ga0111539_10010290All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis11776Open in IMG/M
3300009094|Ga0111539_11393734All Organisms → cellular organisms → Archaea813Open in IMG/M
3300009553|Ga0105249_12869985All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.553Open in IMG/M
3300009553|Ga0105249_13394331All Organisms → cellular organisms → Archaea513Open in IMG/M
3300009795|Ga0105059_1000075All Organisms → cellular organisms → Archaea8532Open in IMG/M
3300009799|Ga0105075_1004797All Organisms → cellular organisms → Archaea1102Open in IMG/M
3300009800|Ga0105069_1000638All Organisms → cellular organisms → Archaea1980Open in IMG/M
3300009808|Ga0105071_1082968Not Available562Open in IMG/M
3300009814|Ga0105082_1000380All Organisms → cellular organisms → Archaea4154Open in IMG/M
3300009816|Ga0105076_1000058All Organisms → cellular organisms → Archaea7427Open in IMG/M
3300009817|Ga0105062_1124037All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.525Open in IMG/M
3300009822|Ga0105066_1166543All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.511Open in IMG/M
3300010301|Ga0134070_10440226Not Available520Open in IMG/M
3300010336|Ga0134071_10005675All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis4776Open in IMG/M
3300010396|Ga0134126_12794534All Organisms → cellular organisms → Archaea529Open in IMG/M
3300010397|Ga0134124_12169117All Organisms → cellular organisms → Archaea595Open in IMG/M
3300012081|Ga0154003_1065983All Organisms → cellular organisms → Archaea619Open in IMG/M
3300012201|Ga0137365_10000288All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis32007Open in IMG/M
3300012360|Ga0137375_11379283All Organisms → cellular organisms → Archaea526Open in IMG/M
3300012478|Ga0157328_1000511All Organisms → cellular organisms → Archaea1438Open in IMG/M
3300012489|Ga0157349_1000112All Organisms → cellular organisms → Archaea3483Open in IMG/M
3300012900|Ga0157292_10387876Not Available526Open in IMG/M
3300012976|Ga0134076_10054168All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus → Candidatus Nitrosocosmicus oleophilus1519Open in IMG/M
3300013308|Ga0157375_12505673All Organisms → cellular organisms → Archaea616Open in IMG/M
3300013308|Ga0157375_12797590All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.583Open in IMG/M
3300014265|Ga0075314_1004106All Organisms → cellular organisms → Archaea2583Open in IMG/M
3300014326|Ga0157380_10507154All Organisms → cellular organisms → Archaea1173Open in IMG/M
3300015373|Ga0132257_101197416All Organisms → cellular organisms → Archaea961Open in IMG/M
3300017656|Ga0134112_10144815All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.911Open in IMG/M
3300017792|Ga0163161_11980571Not Available518Open in IMG/M
3300017997|Ga0184610_1011943All Organisms → cellular organisms → Archaea2198Open in IMG/M
3300017997|Ga0184610_1015923All Organisms → cellular organisms → Archaea1967Open in IMG/M
3300018000|Ga0184604_10215641All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.664Open in IMG/M
3300018027|Ga0184605_10102476All Organisms → cellular organisms → Archaea1264Open in IMG/M
3300018027|Ga0184605_10470101All Organisms → cellular organisms → Archaea551Open in IMG/M
3300018028|Ga0184608_10138794All Organisms → cellular organisms → Archaea1041Open in IMG/M
3300018028|Ga0184608_10457555Not Available549Open in IMG/M
3300018031|Ga0184634_10009646All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae3401Open in IMG/M
3300018031|Ga0184634_10039944All Organisms → cellular organisms → Archaea1899Open in IMG/M
3300018051|Ga0184620_10022775All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.1575Open in IMG/M
3300018051|Ga0184620_10350664All Organisms → cellular organisms → Archaea501Open in IMG/M
3300018052|Ga0184638_1000368All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis12437Open in IMG/M
3300018053|Ga0184626_10001104All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae9208Open in IMG/M
3300018053|Ga0184626_10002319All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis6925Open in IMG/M
3300018054|Ga0184621_10016744All Organisms → cellular organisms → Archaea2200Open in IMG/M
3300018054|Ga0184621_10223625All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.674Open in IMG/M
3300018056|Ga0184623_10000097All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis33726Open in IMG/M
3300018061|Ga0184619_10059230All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.1677Open in IMG/M
3300018063|Ga0184637_10009891All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae5729Open in IMG/M
3300018075|Ga0184632_10003133All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae6894Open in IMG/M
3300018077|Ga0184633_10138299All Organisms → Viruses → Predicted Viral1262Open in IMG/M
3300018081|Ga0184625_10640797All Organisms → cellular organisms → Archaea516Open in IMG/M
3300018084|Ga0184629_10216697All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.993Open in IMG/M
3300018465|Ga0190269_10571891All Organisms → cellular organisms → Archaea755Open in IMG/M
3300018465|Ga0190269_10884407All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.657Open in IMG/M
3300018466|Ga0190268_10023002All Organisms → cellular organisms → Archaea2069Open in IMG/M
3300018466|Ga0190268_10067056All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.1515Open in IMG/M
3300018466|Ga0190268_11129731All Organisms → cellular organisms → Archaea641Open in IMG/M
3300018920|Ga0190273_10195171All Organisms → cellular organisms → Archaea1261Open in IMG/M
3300019878|Ga0193715_1000161All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae17818Open in IMG/M
3300019884|Ga0193741_1000003All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis81213Open in IMG/M
3300020003|Ga0193739_1004707All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae3675Open in IMG/M
3300020018|Ga0193721_1114424Not Available682Open in IMG/M
3300021078|Ga0210381_10055541All Organisms → cellular organisms → Archaea1199Open in IMG/M
3300021972|Ga0193737_1000003All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis65917Open in IMG/M
3300021972|Ga0193737_1016442All Organisms → cellular organisms → Archaea1024Open in IMG/M
3300022694|Ga0222623_10368612All Organisms → cellular organisms → Archaea547Open in IMG/M
3300023071|Ga0247752_1009656All Organisms → cellular organisms → Archaea1306Open in IMG/M
3300025290|Ga0207673_1007877All Organisms → cellular organisms → Archaea1342Open in IMG/M
3300025312|Ga0209321_10115449All Organisms → cellular organisms → Archaea1469Open in IMG/M
3300025314|Ga0209323_10527327All Organisms → cellular organisms → Archaea682Open in IMG/M
3300025315|Ga0207697_10000213All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis30994Open in IMG/M
3300025318|Ga0209519_10555732All Organisms → cellular organisms → Archaea637Open in IMG/M
3300025319|Ga0209520_10371463All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.863Open in IMG/M
3300025904|Ga0207647_10253871All Organisms → cellular organisms → Archaea1008Open in IMG/M
3300025908|Ga0207643_10000301All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis34169Open in IMG/M
3300025908|Ga0207643_10002067All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae11070Open in IMG/M
3300025914|Ga0207671_10113622All Organisms → cellular organisms → Archaea2063Open in IMG/M
3300025926|Ga0207659_10803184All Organisms → cellular organisms → Archaea808Open in IMG/M
3300025926|Ga0207659_11193338All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.654Open in IMG/M
3300025934|Ga0207686_11158558All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.632Open in IMG/M
3300025940|Ga0207691_10069798All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae3173Open in IMG/M
3300025945|Ga0207679_11963774All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.533Open in IMG/M
3300025972|Ga0207668_11185743All Organisms → cellular organisms → Archaea686Open in IMG/M
3300026023|Ga0207677_11734879All Organisms → cellular organisms → Archaea579Open in IMG/M
3300026041|Ga0207639_11382872All Organisms → cellular organisms → Archaea661Open in IMG/M
3300026045|Ga0208535_1003911All Organisms → cellular organisms → Archaea1535Open in IMG/M
3300026324|Ga0209470_1004447All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae9359Open in IMG/M
3300026324|Ga0209470_1053458All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus1937Open in IMG/M
3300026324|Ga0209470_1064712All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus1715Open in IMG/M
3300026536|Ga0209058_1009046All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Nitrososphaera → Candidatus Nitrososphaera evergladensis7273Open in IMG/M
3300026750|Ga0207483_101851All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.837Open in IMG/M
3300026753|Ga0207528_102474All Organisms → cellular organisms → Archaea651Open in IMG/M
3300026782|Ga0207595_100203All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus1392Open in IMG/M
3300026818|Ga0207634_103227All Organisms → cellular organisms → Archaea635Open in IMG/M
3300026841|Ga0207490_1006111All Organisms → cellular organisms → Archaea607Open in IMG/M
3300026888|Ga0209900_1006227All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.876Open in IMG/M
3300027006|Ga0209896_1000053All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae8720Open in IMG/M
3300027013|Ga0209884_1000009All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae38772Open in IMG/M
3300027032|Ga0209877_1029573All Organisms → cellular organisms → Archaea546Open in IMG/M
3300027041|Ga0209876_1015785All Organisms → cellular organisms → Archaea592Open in IMG/M
3300027209|Ga0209875_1000436All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus5806Open in IMG/M
3300027252|Ga0209973_1004183All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus1467Open in IMG/M
3300027428|Ga0207617_101855All Organisms → cellular organisms → Archaea842Open in IMG/M
3300027523|Ga0208890_1068164All Organisms → cellular organisms → Archaea578Open in IMG/M
3300027526|Ga0209968_1103041All Organisms → cellular organisms → Archaea521Open in IMG/M
3300027560|Ga0207981_1007981All Organisms → cellular organisms → Archaea1877Open in IMG/M
3300027637|Ga0209818_1000491All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae8797Open in IMG/M
3300027637|Ga0209818_1007124All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota2192Open in IMG/M
3300027639|Ga0209387_1249806All Organisms → cellular organisms → Archaea505Open in IMG/M
3300027948|Ga0209858_1000325All Organisms → cellular organisms → Archaea3019Open in IMG/M
3300028711|Ga0307293_10051452All Organisms → Viruses → Predicted Viral1280Open in IMG/M
3300028718|Ga0307307_10038003All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus1386Open in IMG/M
3300028755|Ga0307316_10266558All Organisms → cellular organisms → Archaea624Open in IMG/M
3300028878|Ga0307278_10147493All Organisms → cellular organisms → Archaea1054Open in IMG/M
3300031099|Ga0308181_1079142All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.677Open in IMG/M
3300031538|Ga0310888_10252016All Organisms → cellular organisms → Archaea991Open in IMG/M
3300031716|Ga0310813_12187658All Organisms → cellular organisms → Archaea523Open in IMG/M
3300031940|Ga0310901_10157397All Organisms → cellular organisms → Archaea875Open in IMG/M
3300032180|Ga0307471_100587002All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrososphaeria → Nitrososphaerales → Nitrososphaeraceae → Candidatus Nitrosocosmicus1272Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment12.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.61%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand8.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil4.47%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.35%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.35%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.79%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.23%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere2.23%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.23%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.12%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.12%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.12%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.12%
Rhizosphere And Bulk SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Rhizosphere And Bulk Soil1.12%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere1.12%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.12%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.12%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.12%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.68%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.68%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.68%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.56%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.56%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.56%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.56%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.56%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.56%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.56%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.56%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil0.56%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.56%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.56%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.56%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.56%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090015Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
2140918002Rhizosphere and bulk soil microbial communities from the Great Lakes - Sample MSB1EnvironmentalOpen in IMG/M
3300000043Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphereHost-AssociatedOpen in IMG/M
3300000044Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis soil oldHost-AssociatedOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002090Soil microbial communities from Manhattan, Kansas, USA - Sample 200um MDAEnvironmentalOpen in IMG/M
3300002099Soil microbial communities from Manhattan, Kansas, USA - Sample 400um MDAEnvironmentalOpen in IMG/M
3300002126Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5Host-AssociatedOpen in IMG/M
3300003267Sugarcane bulk soil Sample L1EnvironmentalOpen in IMG/M
3300003316Sugarcane root Sample L1Host-AssociatedOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300003382Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AMHost-AssociatedOpen in IMG/M
3300003987Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005159Soil and rhizosphere microbial communities from Laval, Canada - mgLPBEnvironmentalOpen in IMG/M
3300005161Soil and rhizosphere microbial communities from Laval, Canada - mgLPAEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005169Soil and rhizosphere microbial communities from Laval, Canada - mgHPAEnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005269Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 Bulk SoilEnvironmentalOpen in IMG/M
3300005276Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5Host-AssociatedOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009795Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50EnvironmentalOpen in IMG/M
3300009799Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30EnvironmentalOpen in IMG/M
3300009800Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40EnvironmentalOpen in IMG/M
3300009808Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50EnvironmentalOpen in IMG/M
3300009814Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60EnvironmentalOpen in IMG/M
3300009816Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10EnvironmentalOpen in IMG/M
3300009817Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20EnvironmentalOpen in IMG/M
3300009822Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010336Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300012081Attine ant fungus gardens microbial communities from Florida, USA - TSFL087 MetaGHost-AssociatedOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012478Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610Host-AssociatedOpen in IMG/M
3300012489Unplanted soil (control) microbial communities from North Carolina - M.Soil.5.yng.040610EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014265Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019878Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m2EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021972Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300025290Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5Host-AssociatedOpen in IMG/M
3300025312Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4EnvironmentalOpen in IMG/M
3300025314Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 2EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025318Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1EnvironmentalOpen in IMG/M
3300025319Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1EnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026045Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026536Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes)EnvironmentalOpen in IMG/M
3300026750Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK01-B (SPAdes)EnvironmentalOpen in IMG/M
3300026753Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A4a-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026782Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G07A2-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026818Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05A2-11 (SPAdes)EnvironmentalOpen in IMG/M
3300026841Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A3a-10 (SPAdes)EnvironmentalOpen in IMG/M
3300026888Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027006Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027013Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027032Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027041Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027209Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027252Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027428Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A2-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300027526Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027560Soil and rhizosphere microbial communities from Laval, Canada - mgLPC (SPAdes)EnvironmentalOpen in IMG/M
3300027637Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027948Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 (SPAdes)EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300031099Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031940Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPICI_022448602088090015SoilMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH
MSB1_000091202140918002Rhizosphere And Bulk SoilMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDNDLISSYEKH
MSB1_000920902140918002Rhizosphere And Bulk SoilMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLLSFYEKH
ARcpr5yngRDRAFT_02325313300000043Arabidopsis RhizosphereIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH*
ARSoilOldRDRAFT_01087513300000044Arabidopsis RhizosphereKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH*
F14TC_10020776223300000559SoilMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH*
F14TC_10382965223300000559SoilMKCGICKEEIIKEKRREHLKHHKLDDTLVEWIIETDNDLISSYEKY*
JGI10213J12805_1013097613300000858SoilMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISFYERH*
JGI10214J12806_1195072183300000891SoilMLNGSLPLSQPNLFMKCGICKEEIIKDKRREHLRYHKLDDTLAEWIIETDDDLISENRN*
F14TB_10023841023300001431SoilMKCGICKQEIIKEKRREHLKYHKLDDTLVEWIIETDNDLISSYEKY*
JGI24806J26614_101593223300002090SoilMKCGICKEEIIKEKRREHLKYHKLDDTLVQWIIETDNDLISSYEKH*
JGI24808J26613_105783613300002099SoilMKCGICKEEIIKDKRRAHLKHHKLDDTLVEWIIETDNDLISSYEKY*
JGI24035J26624_103205423300002126Corn, Switchgrass And Miscanthus RhizosphereMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEXH*
soilL1_10008294303300003267Sugarcane Root And Bulk SoilMKCGICKEEIIKDKRREHLRYHKLDDTLVEWIIETDDDLISLYEK*
rootH1_1018696833300003316Sugarcane Root And Bulk SoilNLFMKCGICKEEIIKDKRREHLRYHKLDDTLAEWIIETDDNLISTNNRN*
soilL2_1006360053300003319Sugarcane Root And Bulk SoilMKCGICKEEIIKDKRREHLRYHKLDDTLVEWIIETDDDLISTKNRV*
soilL2_1014532443300003319Sugarcane Root And Bulk SoilMKCGICKEEIIKHKRREHLRYHKLDDTLVEWIIETDDDLISLYEK*
JGI26139J50223_100002143300003382Arabidopsis Thaliana RhizosphereVIYILKLYLDLPLPNLFMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH*
Ga0055471_1020858023300003987Natural And Restored WetlandsMKCGICKEEIIREKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH*
Ga0062590_10247345013300004157SoilQPNLFMKCGICKEEIIKDKRREHLRYHKLDDTLAEWIIETDDDLISENRN*
Ga0063356_10266225813300004463Arabidopsis Thaliana RhizosphereMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH*
Ga0063356_10406094313300004463Arabidopsis Thaliana RhizosphereMKCGICKEEIIKDKRREHLRYHKLDDTLAEWIIETDDDLISENRN*
Ga0062595_10022785223300004479SoilMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH*
Ga0066808_100157433300005159SoilTLTLPVPNLFMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH*
Ga0066807_100681933300005161SoilVPNLFMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH*
Ga0066809_1000712933300005168SoilMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH*
Ga0066810_1000041423300005169SoilLTLPVPNLFMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH*
Ga0066676_1000113423300005186SoilMKCGICKEEILREKRREHLKYHKLDETLVDWIIETDDDLISFFEKH*
Ga0066676_1004911333300005186SoilMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLKSFYEKH*
Ga0066676_1056050413300005186SoilMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYKKH*
Ga0065706_100013843300005269Switchgrass RhizosphereLTLPLPNHFMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDNDLISSYEKH*
Ga0065717_100044533300005276Arabidopsis RhizosphereLTLPVPNLSMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH*
Ga0065704_1000628953300005289Switchgrass RhizosphereMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDNDLISSYEKH*
Ga0065704_1081553213300005289Switchgrass RhizosphereTLPVPNLSMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH*
Ga0065705_1000003933300005294Switchgrass RhizosphereMKCGICKEEIIKEXRREHLKYHKLDDTLVEWIIETDDDLISFYEKH*
Ga0065705_10000146213300005294Switchgrass RhizosphereMKCGICKEEIIKEKRREHLKYHKLDDTLVEWXIETDNDLISSYEKH*
Ga0065705_1046375813300005294Switchgrass RhizosphereYTLTLPVPNLFMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH*
Ga0068869_10203545423300005334Miscanthus RhizosphereMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLI
Ga0068868_10002341233300005338Miscanthus RhizosphereLTLPPPNLFMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH*
Ga0070669_100007901133300005353Switchgrass RhizosphereCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH*
Ga0070669_10117425113300005353Switchgrass RhizosphereMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLIS
Ga0070700_10069013813300005441Corn, Switchgrass And Miscanthus RhizosphereFMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDNDLISSYEKH*
Ga0066686_1002940933300005446SoilLTLPVPNLFMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYKKH*
Ga0066686_1014840043300005446SoilLTLRVPNLFMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLKSFYEKH*
Ga0066686_1090903013300005446SoilNLFMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH*
Ga0070678_10082384323300005456Miscanthus RhizosphereVPNLSMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH*
Ga0068867_10021580623300005459Miscanthus RhizosphereLTLPLPNLFMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH*
Ga0070672_10023092513300005543Miscanthus RhizosphereKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH*
Ga0070696_10074644423300005546Corn, Switchgrass And Miscanthus RhizosphereMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISSYEKH*
Ga0070702_10010141713300005615Corn, Switchgrass And Miscanthus RhizosphereMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFY
Ga0068862_10026509713300005844Switchgrass RhizosphereEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH*
Ga0075417_1002247633300006049Populus RhizosphereMKCGICKEEIIREKRREHLRFHKLDDTLVEWIIETDDDLISSYEKH*
Ga0068871_10017740913300006358Miscanthus RhizosphereKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH*
Ga0075421_10072532233300006845Populus RhizosphereFMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH*
Ga0075421_10193768213300006845Populus RhizosphereMKCGICKEEIIREKRREHLRFHKLDDTLVEWLIETDDDLISLYEKH*
Ga0075430_10011368313300006846Populus RhizosphereMKCGICKEEIIREKRRQHLRYHKLDDTLVEWIIETDDDLISSYEKH*
Ga0079217_1000143173300006876Agricultural SoilMKCGICKEEIIREKRREHLRFHKLDDTLVEWLIKTDDDLISIYEKH*
Ga0079215_1000212573300006894Agricultural SoilMKCGICNEEIIREKRREHLRFHKLDDTLVEWLIETDDDLISLYEKH*
Ga0066710_10004257913300009012Grasslands SoilMKCGICKEEILREKRRKHLKYHKLDETLVEWIIETDDDLISFFEKH
Ga0111539_10010290133300009094Populus RhizosphereVPNLSMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWII
Ga0111539_1139373413300009094Populus RhizosphereEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH*
Ga0105249_1286998523300009553Switchgrass RhizosphereMKCGICKEEIIKEKRIEHLRYHKLDDTLVEWIIETDDDLISSYEK
Ga0105249_1339433113300009553Switchgrass RhizosphereICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH*
Ga0105059_100007563300009795Groundwater SandMKCGICKEEIIREKRREHLKYHRLDDTLVEWIIETDDHLISFYEKH*
Ga0105075_100479713300009799Groundwater SandMKCGICKEDIIREKRREHLKYHRLDDTLVEWIIETDDHLISFYEKH*
Ga0105069_100063833300009800Groundwater SandVPNLLMKCGICKEEIIREKRREHLKYHRLDDTLVEWIIETDDHLISFYEKH*
Ga0105071_108296813300009808Groundwater SandVPNLFMKCGICKEEIIREKRREHLKYHKLDDTLVQWIIETDDDLISFYEKH*
Ga0105082_100038043300009814Groundwater SandMKCGICKEEIIREKRREHLKYHRLDDTLVEWIIETDDDLISFYEKH*
Ga0105076_100005833300009816Groundwater SandMKCGICKEEILREKRREHLKYHRLDDTLVEWIIETDDHLISFYEKH*
Ga0105062_112403713300009817Groundwater SandMKCGICKEEIIREKRREHLKYHRLDDTLVEWIIETDDHLI
Ga0105066_116654323300009822Groundwater SandMKCGICKEEIIREKRREHLKYHRLDDTLVEWIIETDD
Ga0134070_1044022613300010301Grasslands SoilVPNLFMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYKKH*
Ga0134071_1000567573300010336Grasslands SoilMKCGICKEEILREKRREHLKYHKLDETLVEWIIETDDDLISFFEKH*
Ga0134126_1279453413300010396Terrestrial SoilIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH*
Ga0134124_1216911713300010397Terrestrial SoilKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH*
Ga0154003_106598313300012081Attine Ant Fungus GardensMKCGICKEEIIKDKRREHLRYHKLDDTLAEWIIETDDNLISTKNRN*
Ga0137365_1000028833300012201Vadose Zone SoilMKCGICKEEILREKRRKHLKYHKLDETLVEWIIETDDDLISFFEKH*
Ga0137375_1137928313300012360Vadose Zone SoilVPNLFMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISFFEKH*
Ga0157328_100051113300012478Arabidopsis RhizosphereTLTLPVPNLSMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH*
Ga0157349_100011213300012489Unplanted SoilEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH*
Ga0157292_1038787613300012900SoilMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDNDLISSYEKY*
Ga0134076_1005416833300012976Grasslands SoilVPNLFMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLKSFYEKH*
Ga0157375_1250567313300013308Miscanthus RhizosphereKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH*
Ga0157375_1279759023300013308Miscanthus RhizosphereVPNLSMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEK
Ga0075314_100410633300014265Natural And Restored WetlandsMKCGICKEEIIREKRREHLRFHKLDDTLVEWLIETDDDLTSPYEKH*
Ga0157380_1050715423300014326Switchgrass RhizosphereVPNLSMKCGICKEEIIKEKRRDHLKYHKLDDILVEWIIETDDDLISFYEKH*
Ga0132257_10119741613300015373Arabidopsis RhizosphereEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKY*
Ga0134112_1014481523300017656Grasslands SoilVPNLFMKCGICKEEIIREKRREHLKYHKLDETLVDWIIETDDDLISFYEKH
Ga0163161_1198057123300017792Switchgrass RhizosphereMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH
Ga0184610_101194313300017997Groundwater SedimentVPNLFMKCGICKEEIIREKRREHLKYHKLDDTLVQWIIETDDDLISFYEKH
Ga0184610_101592323300017997Groundwater SedimentMKCGICKQEIIKEKRRDHLRYHKLDDTLVEWIIETDDDLISSYEKN
Ga0184604_1021564113300018000Groundwater SedimentMKCGICKEEIIREKRREHLKHHKLDDTLVKWIIETDDDLISFYEKH
Ga0184605_1010247623300018027Groundwater SedimentMKCGICKQEIIKEKRRDHLRYHKLDDTLVEWIIETDDDLISSYEKH
Ga0184605_1047010113300018027Groundwater SedimentMKCGICKEEILREKRREHLKYHKLDETLVEWIIETDDDLISFFEKH
Ga0184608_1013879413300018028Groundwater SedimentMKCGICKEEIIKEKRREHLKYHKLDDTLVQWIIETDDDLISSYEKH
Ga0184608_1045755513300018028Groundwater SedimentMKCGICKQEIIKEKRRDHLRYHKLDDTLVEWIIETDNDLISSYEKH
Ga0184634_1000964643300018031Groundwater SedimentLTLPVANLFMKCGICKEEIIREKRREHLKYHKLDDTLVQWIIETDDDLISFYEKH
Ga0184634_1003994423300018031Groundwater SedimentLTLPVPNLFMKCGICREEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH
Ga0184620_1002277533300018051Groundwater SedimentVPNLFMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH
Ga0184620_1035066413300018051Groundwater SedimentMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISSYEKN
Ga0184638_100036813300018052Groundwater SedimentLTLPVPNLFMKCGICREEIIREKRREHLKHHKLDDTLVEWIIETDDDLISFYEKH
Ga0184626_1000110423300018053Groundwater SedimentMKCGICKEEIIKEKRKEHLKYHKLDDTLVEWIIETDDDLISFYEKH
Ga0184626_1000231923300018053Groundwater SedimentMKCGICKQEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISSYEKH
Ga0184621_1001674423300018054Groundwater SedimentLPNLFMKCGICKQEIIKEKRRDHLRYHKLDDTLVEWIIETDDDLISSYEKH
Ga0184621_1022362513300018054Groundwater SedimentMKCGICKQEIIKEKRRDHLRYHKLDDTLVEWIIETD
Ga0184623_1000009783300018056Groundwater SedimentMKCGICKEEIIREKRREHLKYHKLDDTLVQWIIETDDDLISFYEKH
Ga0184619_1005923023300018061Groundwater SedimentVPNLFMKCGICKEEIIREKRREHLKHHKLDDTLVKWIIETDDDLISFYEKH
Ga0184637_1000989153300018063Groundwater SedimentMKCGICKQEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH
Ga0184632_1000313383300018075Groundwater SedimentMKCGICREEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH
Ga0184633_1013829913300018077Groundwater SedimentTLRVPNLFMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH
Ga0184625_1064079713300018081Groundwater SedimentMKCGICKEEIIKEKRREHLKYHKLDDTLVQWIIETDDDLISYEKH
Ga0184629_1021669723300018084Groundwater SedimentMKCGICKEEIIKEKSREHLKYHKLDDTLVEWIIETDDDLISSYEKN
Ga0190269_1057189113300018465SoilMKCGICKEEIIREKRREHLRFHKLDDTLVEWLIETDDDLISLYEKH
Ga0190269_1088440723300018465SoilVPNLLMKCGICKEEIIREKRREHLKYHRLDDTLVEWIIETDDHLISFYEKH
Ga0190268_1002300223300018466SoilMKCGICKEEIIREKRREHLRFHKLDDTLVEWLIKTDDDLISIYEKH
Ga0190268_1006705613300018466SoilMKCGICKEEIIREKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH
Ga0190268_1112973123300018466SoilMKCGICKEELIREKRREHLRFHKLDDTLVEWLIETDDDLISLYEKH
Ga0190273_1019517123300018920SoilMKCGICKEEIIREKRREHLRFHKLDDTLVEWLIETDDDLISLYDKH
Ga0193715_1000161153300019878SoilMKCGICKQEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISSYEKH
Ga0193741_1000003483300019884SoilMKCGICKEEIIREKRRGHLRFHKLDDTLVEWLIETDDDLISLYEKH
Ga0193739_100470713300020003SoilMKCGICKEEIIREKRREHLRYHKLGDTLVEWIIETDDDLISSYEKH
Ga0193721_111442413300020018SoilNYTLTLPVPNLFMKCGICKEEIIREKRREHLKHHKLDDTLVKWIIETDDDLISFYEKH
Ga0210381_1005554123300021078Groundwater SedimentCTLTLSLPNLFMKCGICKQEIIKEKRRDHLRYHKLDDTLVEWIIETDNDLISSYEKH
Ga0193737_1000003423300021972SoilMKCGICKEEIIREKRRVHLRFHKLDDTLVEWLIETDDDLISLYEKH
Ga0193737_101644213300021972SoilREKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH
Ga0222623_1036861213300022694Groundwater SedimentIKEKRREHLKHHKLDDTLVKWIIETDDDLISFYEKH
Ga0247752_100965623300023071SoilKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH
Ga0207673_100787713300025290Corn, Switchgrass And Miscanthus RhizosphereMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH
Ga0209321_1011544913300025312SoilLTLQQPNLFMKCGICKEEIIREKRREHLRFHKLDDTLVEWLIETDDDLISLYEKH
Ga0209323_1052732713300025314SoilSQPNLFMKCGICKEEIIREKRREHLRFHKLDDTLVEWLIETDDDLISLYEKH
Ga0207697_10000213283300025315Corn, Switchgrass And Miscanthus RhizosphereLTLPVPNLSMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH
Ga0209519_1055573213300025318SoilLTLPQPNLFMKCGICKEEIIREKRREHLRFHKLDDTLVEWLIETDDDLISLYEKH
Ga0209520_1037146313300025319SoilMKCGICKEEIIREKRREHLRFHKLDDTLVEWLIKTDDDLISLYEKH
Ga0207647_1025387113300025904Corn RhizosphereEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH
Ga0207643_1000030173300025908Miscanthus RhizosphereMKCGICKEEIIKDKRREHLRYHKLDDTLAEWIIETDDDLISENRN
Ga0207643_10002067123300025908Miscanthus RhizosphereMKGGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH
Ga0207671_1011362233300025914Corn RhizosphereVPNLSMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH
Ga0207659_1080318413300025926Miscanthus RhizosphereSMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH
Ga0207659_1119333813300025926Miscanthus RhizosphereMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLI
Ga0207686_1115855813300025934Miscanthus RhizosphereMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIET
Ga0207691_1006979813300025940Miscanthus RhizosphereMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKP
Ga0207679_1196377413300025945Corn RhizosphereMKCGICKEKIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH
Ga0207668_1118574313300025972Switchgrass RhizosphereICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKP
Ga0207677_1173487913300026023Miscanthus RhizosphereCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH
Ga0207639_1138287213300026041Corn RhizosphereLTLPPPNLFMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH
Ga0208535_100391113300026045Natural And Restored WetlandsMKCGICKEEIIREKRREHLRFHKLDDTLVEWLIETDDDLTSPYEKH
Ga0209470_1004447103300026324SoilMKCGICKEEILREKRREHLKYHKLDETLVDWIIETDDDLISFFEKH
Ga0209470_105345833300026324SoilVPNLFMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYKKH
Ga0209470_106471233300026324SoilMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLKSFYEKH
Ga0209058_100904673300026536SoilMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYKKH
Ga0207483_10185113300026750SoilMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIET
Ga0207528_10247413300026753SoilMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISSYEKH
Ga0207595_10020333300026782SoilMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSY
Ga0207634_10322713300026818SoilPNLFMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH
Ga0207490_100611113300026841SoilTLPLPNLFMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH
Ga0209900_100622733300026888Groundwater SandMKCGICKEDIIREKRREHLKYHRLDDTLVEWIIETDDHLISFY
Ga0209896_100005393300027006Groundwater SandMKCGICKEDIIREKRREHLKYHRLDDTLVEWIIETDDHLISFYEKH
Ga0209884_1000009393300027013Groundwater SandMKCGICKEEIIREKRREHLKYHRLDDTLVEWIIETDDHLISFYEKH
Ga0209877_102957313300027032Groundwater SandEDIIREKRREHLKYHRLDDTLVEWIIETDDHLISFYEKH
Ga0209876_101578513300027041Groundwater SandKIILLTLSVPNLFMKCGICKEDIIREKRREHLKYHRLDDTLVEWIIETDDHLISFYEKH
Ga0209875_100043663300027209Groundwater SandMKCGICKEEILREKRREHLKYHRLDDTLVEWIIETDDHLISFYEKH
Ga0209973_100418333300027252Arabidopsis Thaliana RhizosphereMKCGICKEEIIKDKRREHLRYHKLDDTLAEWIIETDDDL
Ga0207617_10185513300027428SoilCKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH
Ga0208890_106816423300027523SoilVPNLFMKCGICKEEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH
Ga0209968_110304123300027526Arabidopsis Thaliana RhizosphereLSQPNLFMKCGICKEEIIKDKRREHLRYHKLDDTLAEWIIETDDDLISENRN
Ga0207981_100798113300027560SoilEIIREKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH
Ga0209818_100049113300027637Agricultural SoilIYMLKWYFDITTANLFMKCGICKEEIIREKRREHLRFHKLDDTLVEWLIKTDDDLISIYEKH
Ga0209818_100712443300027637Agricultural SoilMKCGICKEEIIREKRREHLRFHKLDDTLVEWLIKTDDDL
Ga0209387_124980613300027639Agricultural SoilPNLFMKCGICKEEIIREKRREHLRFHKLDDTLVEWLIETDDDLISLYEKH
Ga0209858_100032553300027948Groundwater SandLTLPVPNLLMKCGICKEEIIREKRREHLKYHRLDDTLVEWIIETDDHLISFYEKH
Ga0307293_1005145223300028711SoilLRVPNLFMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH
Ga0307307_1003800313300028718SoilMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISFYE
Ga0307316_1026655813300028755SoilMKCGICKEEIIKEKRREHLKYNKLDDTLVEWIIETDDDLISFYEKH
Ga0307278_1014749313300028878SoilRVPNLFMKCGICKEEIIKEKRREHLKYHKLDDTLVEWIIETDDDLISFYEKH
Ga0308181_107914223300031099SoilVPNLFMKCGICKEEIIKEKRKEHLKYHKLDDTLVEWIIETDDDLISFYEKH
Ga0310888_1025201613300031538SoilPVPNLSMKCGICKEEIIKEKRRDHLKYHKLDDTLVEWIIETDDDLISFYEKH
Ga0310813_1218765823300031716SoilLPPPNLFMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH
Ga0310901_1015739713300031940SoilLPLPNLFMKCGICKEEIIKEKRREHLRYHKLDDTLVEWIIETDDDLISSYEKH
Ga0307471_10058700213300032180Hardwood Forest SoilMKCGICKEEIIKEKRREHLKYHRLDDTLVEWIIETDDDLISSYEKP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.