Metagenome / Metatranscriptome Family F048660

Basic Information
Family ID	F048660
Family Type	Metagenome / Metatranscriptome
Number of Sequences	148
Average Sequence Length	42 residues
Representative Sequence	MKRASIGLGILVTFFLLAMFLMADAEVTPVDDPALISASAPAR
Number of Associated Samples	130
Number of Associated Scaffolds	148

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	85.14 %
% of genes near scaffold ends (potentially truncated)	23.65 %
% of genes from short scaffolds (< 2000 bps)	77.70 %
Associated GOLD sequencing projects	125
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.44

Most Common Taxonomy
Group	Bacteria (72.297 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (11.486 % of family members)
Environment Ontology (ENVO)	Unclassified (32.432 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (34.459 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 30.99% β-sheet: 0.00% Coil/Unstructured: 69.01%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 148 Family Scaffolds
PF00072	Response_reg	50.00
PF09130	DUF1932	6.08
PF02310	B12-binding	4.05
PF04055	Radical_SAM	2.70
PF03446	NAD_binding_2	2.70
PF02705	K_trans	1.35
PF00982	Glyco_transf_20	1.35
PF04392	ABC_sub_bind	0.68
PF06508	QueC	0.68
PF02775	TPP_enzyme_C	0.68
PF00440	TetR_N	0.68
PF13525	YfiO	0.68
PF02771	Acyl-CoA_dh_N	0.68
PF02954	HTH_8	0.68
PF00012	HSP70	0.68
PF11839	Alanine_zipper	0.68
PF00005	ABC_tran	0.68
PF00528	BPD_transp_1	0.68
PF12860	PAS_7	0.68
PF00691	OmpA	0.68
PF03807	F420_oxidored	0.68

COG ID	Name	Functional Category	% Frequency in 148 Family Scaffolds
COG2084	3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase	Lipid transport and metabolism [I]	6.08
COG0380	Trehalose-6-phosphate synthase, GT20 family	Carbohydrate transport and metabolism [G]	1.35
COG3158	K+ uptake protein Kup	Inorganic ion transport and metabolism [P]	1.35
COG0037	tRNA(Ile)-lysidine synthase TilS/MesJ	Translation, ribosomal structure and biogenesis [J]	0.68
COG0137	Argininosuccinate synthase	Amino acid transport and metabolism [E]	0.68
COG0171	NH3-dependent NAD+ synthetase	Coenzyme transport and metabolism [H]	0.68
COG0301	Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis)	Translation, ribosomal structure and biogenesis [J]	0.68
COG0443	Molecular chaperone DnaK (HSP70)	Posttranslational modification, protein turnover, chaperones [O]	0.68
COG0482	tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain	Translation, ribosomal structure and biogenesis [J]	0.68
COG0519	GMP synthase, PP-ATPase domain/subunit	Nucleotide transport and metabolism [F]	0.68
COG0603	7-cyano-7-deazaguanine synthase (queuosine biosynthesis)	Translation, ribosomal structure and biogenesis [J]	0.68
COG0780	NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily	Translation, ribosomal structure and biogenesis [J]	0.68
COG1606	ATP-utilizing enzyme, PP-loop superfamily	General function prediction only [R]	0.68
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	0.68
COG2984	ABC-type uncharacterized transport system, periplasmic component	General function prediction only [R]	0.68

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	72.97 %
Unclassified	root	N/A	27.03 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	72.97 %
Unclassified	root	N/A	27.03 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	72.30 %
Unclassified	root	N/A	27.03 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.68 %

Name	Rank	Taxonomy	Distribution
Bacteria incertae sedis	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis	31.08 %
Unclassified	root	N/A	27.03 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	5.41 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	0.68 %

Name	Rank	Taxonomy	Distribution
Bacteria candidate phyla	clade	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	31.08 %
Unclassified	root	N/A	27.03 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.68 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.68 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	0.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.03 %
Candidatus Rokubacteria	phylum	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria	14.86 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	0.68 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.68 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.03 %
unclassified Candidatus Rokubacteria	no rank	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria	14.86 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	0.68 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.68 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.03 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	14.86 %
Protostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia	0.68 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.68 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.03 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	14.86 %
Ecdysozoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa	0.68 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.68 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.03 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	14.86 %
Nematoda	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda	0.68 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.68 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.03 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	14.86 %
Chromadorea	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea	0.68 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.68 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.03 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	14.86 %
Rhabditida	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida	0.68 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.68 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.03 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	14.86 %
Rhabditina	suborder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina	0.68 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.68 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.03 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	14.86 %
Rhabditomorpha	infraorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha	0.68 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.68 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.03 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	14.86 %
Rhabditoidea	superfamily	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea	0.68 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.68 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.03 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	14.86 %
Rhabditidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae	0.68 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.68 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.03 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	14.86 %
Rhabditidae incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis	0.68 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.68 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.03 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	14.86 %
Diploscapter	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis → Diploscapter	0.68 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.68 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.03 %
Candidatus Rokubacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	14.86 %
Diploscapter pachys	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis → Diploscapter → Diploscapter pachys	0.68 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.68 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.68 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000443\|F12B_10792803	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	597	Open in IMG/M
3300000574\|JGI1357J11328_10212422	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	518	Open in IMG/M
3300000596\|KanNP_Total_noBrdU_T14TCDRAFT_1023096	All Organisms → cellular organisms → Bacteria	678	Open in IMG/M
3300000956\|JGI10216J12902_106506970	Not Available	894	Open in IMG/M
3300001431\|F14TB_100104231	All Organisms → cellular organisms → Bacteria	3013	Open in IMG/M
3300002886\|JGI25612J43240_1020738	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	970	Open in IMG/M
3300002914\|JGI25617J43924_10361881	Not Available	504	Open in IMG/M
3300003324\|soilH2_10019831	All Organisms → cellular organisms → Bacteria	23071	Open in IMG/M
3300003349\|JGI26129J50193_1008153	All Organisms → cellular organisms → Bacteria	759	Open in IMG/M
3300003502\|JGI26143J51219_1008428	Not Available	551	Open in IMG/M
3300003911\|JGI25405J52794_10136215	Not Available	557	Open in IMG/M
3300003994\|Ga0055435_10010198	All Organisms → cellular organisms → Bacteria	1768	Open in IMG/M
3300004058\|Ga0055498_10030161	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	864	Open in IMG/M
3300004062\|Ga0055500_10011607	All Organisms → cellular organisms → Bacteria → Proteobacteria	1454	Open in IMG/M
3300004463\|Ga0063356_100044451	All Organisms → cellular organisms → Bacteria → Proteobacteria	4421	Open in IMG/M
3300004463\|Ga0063356_100080772	All Organisms → cellular organisms → Bacteria	3434	Open in IMG/M
3300004479\|Ga0062595_101601854	Not Available	607	Open in IMG/M
3300005289\|Ga0065704_10485398	Not Available	678	Open in IMG/M
3300005330\|Ga0070690_100034170	All Organisms → cellular organisms → Bacteria	3186	Open in IMG/M
3300005332\|Ga0066388_100322526	All Organisms → cellular organisms → Bacteria	2191	Open in IMG/M
3300005338\|Ga0068868_100096410	All Organisms → cellular organisms → Bacteria	2389	Open in IMG/M
3300005341\|Ga0070691_10010740	All Organisms → cellular organisms → Bacteria	4180	Open in IMG/M
3300005341\|Ga0070691_10014391	All Organisms → cellular organisms → Bacteria	3629	Open in IMG/M
3300005406\|Ga0070703_10218277	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	758	Open in IMG/M
3300005436\|Ga0070713_100514022	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	1131	Open in IMG/M
3300005439\|Ga0070711_100414844	All Organisms → cellular organisms → Bacteria	1096	Open in IMG/M
3300005445\|Ga0070708_100058861	All Organisms → cellular organisms → Bacteria	3424	Open in IMG/M
3300005468\|Ga0070707_101676120	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	603	Open in IMG/M
3300005529\|Ga0070741_10002028	All Organisms → cellular organisms → Bacteria	56707	Open in IMG/M
3300005546\|Ga0070696_100310448	All Organisms → cellular organisms → Bacteria	1211	Open in IMG/M
3300005610\|Ga0070763_10875966	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	533	Open in IMG/M
3300005713\|Ga0066905_100012825	All Organisms → cellular organisms → Bacteria	4103	Open in IMG/M
3300005875\|Ga0075293_1001963	All Organisms → cellular organisms → Bacteria	1763	Open in IMG/M
3300005937\|Ga0081455_10000506	All Organisms → cellular organisms → Bacteria	50493	Open in IMG/M
3300005937\|Ga0081455_10761738	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	611	Open in IMG/M
3300005985\|Ga0081539_10408674	Not Available	564	Open in IMG/M
3300006574\|Ga0074056_10838961	Not Available	525	Open in IMG/M
3300006845\|Ga0075421_100344105	All Organisms → cellular organisms → Bacteria	1803	Open in IMG/M
3300009087\|Ga0105107_10639708	Not Available	740	Open in IMG/M
3300009088\|Ga0099830_10121186	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	1979	Open in IMG/M
3300009089\|Ga0099828_11192631	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	675	Open in IMG/M
3300009090\|Ga0099827_11270615	Not Available	640	Open in IMG/M
3300009795\|Ga0105059_1041310	Not Available	586	Open in IMG/M
3300010047\|Ga0126382_10439269	All Organisms → cellular organisms → Bacteria → Proteobacteria	1031	Open in IMG/M
3300010362\|Ga0126377_13509646	All Organisms → cellular organisms → Bacteria	507	Open in IMG/M
3300010398\|Ga0126383_12220243	Not Available	635	Open in IMG/M
3300010401\|Ga0134121_10898925	Not Available	860	Open in IMG/M
3300011414\|Ga0137442_1051821	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	829	Open in IMG/M
3300011423\|Ga0137436_1213602	Not Available	506	Open in IMG/M
3300012034\|Ga0137453_1035261	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	862	Open in IMG/M
3300012200\|Ga0137382_11102372	Not Available	567	Open in IMG/M
3300012202\|Ga0137363_10726925	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	841	Open in IMG/M
3300012362\|Ga0137361_11705333	Not Available	549	Open in IMG/M
3300012912\|Ga0157306_10218021	Not Available	653	Open in IMG/M
3300012918\|Ga0137396_10928693	Not Available	636	Open in IMG/M
3300012922\|Ga0137394_10133073	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	2111	Open in IMG/M
3300012929\|Ga0137404_10241834	All Organisms → cellular organisms → Bacteria	1546	Open in IMG/M
3300012929\|Ga0137404_10353374	All Organisms → cellular organisms → Bacteria	1287	Open in IMG/M
3300012931\|Ga0153915_10286846	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1834	Open in IMG/M
3300012961\|Ga0164302_11162975	All Organisms → cellular organisms → Bacteria	614	Open in IMG/M
3300014321\|Ga0075353_1105379	Not Available	665	Open in IMG/M
3300014884\|Ga0180104_1002915	All Organisms → cellular organisms → Bacteria	3592	Open in IMG/M
3300015371\|Ga0132258_10569992	All Organisms → cellular organisms → Bacteria	2839	Open in IMG/M
3300015372\|Ga0132256_102496313	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	618	Open in IMG/M
3300017927\|Ga0187824_10073386	All Organisms → cellular organisms → Bacteria	1077	Open in IMG/M
3300017930\|Ga0187825_10209905	Not Available	703	Open in IMG/M
3300017939\|Ga0187775_10263454	Not Available	666	Open in IMG/M
3300017959\|Ga0187779_11016300	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	576	Open in IMG/M
3300017973\|Ga0187780_10084914	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	2177	Open in IMG/M
3300017997\|Ga0184610_1005155	All Organisms → cellular organisms → Bacteria	3085	Open in IMG/M
3300018000\|Ga0184604_10048617	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	1163	Open in IMG/M
3300018028\|Ga0184608_10325973	Not Available	675	Open in IMG/M
3300018063\|Ga0184637_10302182	Not Available	969	Open in IMG/M
3300018076\|Ga0184609_10283138	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	776	Open in IMG/M
3300018084\|Ga0184629_10055757	All Organisms → cellular organisms → Bacteria	1820	Open in IMG/M
3300018084\|Ga0184629_10108031	All Organisms → cellular organisms → Bacteria	1370	Open in IMG/M
3300018422\|Ga0190265_10032211	All Organisms → cellular organisms → Bacteria	4372	Open in IMG/M
3300018422\|Ga0190265_10038087	All Organisms → cellular organisms → Bacteria	4071	Open in IMG/M
3300018422\|Ga0190265_13336384	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	536	Open in IMG/M
3300018429\|Ga0190272_11142255	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	759	Open in IMG/M
3300018429\|Ga0190272_11754559	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	645	Open in IMG/M
3300018429\|Ga0190272_13259294	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	506	Open in IMG/M
3300019458\|Ga0187892_10008145	All Organisms → cellular organisms → Bacteria	14505	Open in IMG/M
3300019458\|Ga0187892_10064245	All Organisms → cellular organisms → Bacteria	2395	Open in IMG/M
3300019487\|Ga0187893_10665738	Not Available	649	Open in IMG/M
3300019487\|Ga0187893_10972046	Not Available	501	Open in IMG/M
3300019865\|Ga0193748_1009230	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	878	Open in IMG/M
3300019879\|Ga0193723_1012235	All Organisms → cellular organisms → Bacteria → Proteobacteria	2719	Open in IMG/M
3300020060\|Ga0193717_1096507	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	941	Open in IMG/M
3300020580\|Ga0210403_10769207	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	767	Open in IMG/M
3300020581\|Ga0210399_10025161	All Organisms → cellular organisms → Bacteria	4731	Open in IMG/M
3300021073\|Ga0210378_10222710	Not Available	717	Open in IMG/M
3300021080\|Ga0210382_10059764	Not Available	1520	Open in IMG/M
3300021081\|Ga0210379_10385250	Not Available	618	Open in IMG/M
3300021086\|Ga0179596_10363099	Not Available	728	Open in IMG/M
3300021170\|Ga0210400_11489954	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	537	Open in IMG/M
3300021445\|Ga0182009_10016489	All Organisms → cellular organisms → Bacteria	2707	Open in IMG/M
3300021560\|Ga0126371_11559501	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	787	Open in IMG/M
3300022533\|Ga0242662_10264067	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	563	Open in IMG/M
3300023057\|Ga0247797_1066328	Not Available	535	Open in IMG/M
3300023072\|Ga0247799_1001625	All Organisms → cellular organisms → Bacteria	3139	Open in IMG/M
3300025160\|Ga0209109_10135693	All Organisms → cellular organisms → Bacteria	1248	Open in IMG/M
3300025165\|Ga0209108_10088741	All Organisms → cellular organisms → Bacteria	1676	Open in IMG/M
3300025165\|Ga0209108_10359003	Not Available	721	Open in IMG/M
3300025324\|Ga0209640_10462488	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	1039	Open in IMG/M
3300025535\|Ga0207423_1032218	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	894	Open in IMG/M
3300025899\|Ga0207642_10377419	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	843	Open in IMG/M
3300025910\|Ga0207684_10000867	All Organisms → cellular organisms → Bacteria	34569	Open in IMG/M
3300025910\|Ga0207684_10104044	All Organisms → cellular organisms → Bacteria	2427	Open in IMG/M
3300025912\|Ga0207707_10237611	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1585	Open in IMG/M
3300025912\|Ga0207707_10891578	Not Available	736	Open in IMG/M
3300025921\|Ga0207652_11126713	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	685	Open in IMG/M
3300025934\|Ga0207686_11236413	Not Available	612	Open in IMG/M
3300025957\|Ga0210089_1051377	Not Available	531	Open in IMG/M
3300025962\|Ga0210070_1026219	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	687	Open in IMG/M
3300026005\|Ga0208285_1008575	All Organisms → cellular organisms → Bacteria	749	Open in IMG/M
3300026075\|Ga0207708_11094058	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	695	Open in IMG/M
3300026102\|Ga0208914_1044891	Not Available	543	Open in IMG/M
3300026121\|Ga0207683_11896404	Not Available	545	Open in IMG/M
3300026351\|Ga0257170_1022089	All Organisms → cellular organisms → Bacteria	838	Open in IMG/M
3300026508\|Ga0257161_1072848	All Organisms → cellular organisms → Bacteria	705	Open in IMG/M
3300026514\|Ga0257168_1001359	All Organisms → cellular organisms → Bacteria	3204	Open in IMG/M
3300026535\|Ga0256867_10183895	Not Available	771	Open in IMG/M
3300027651\|Ga0209217_1214762	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	513	Open in IMG/M
3300027682\|Ga0209971_1081011	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis → Diploscapter → Diploscapter pachys	790	Open in IMG/M
3300027775\|Ga0209177_10149795	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	790	Open in IMG/M
3300027882\|Ga0209590_10710698	Not Available	642	Open in IMG/M
3300028792\|Ga0307504_10163084	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	765	Open in IMG/M
3300028811\|Ga0307292_10141355	All Organisms → cellular organisms → Bacteria → Proteobacteria	968	Open in IMG/M
3300030006\|Ga0299907_10146682	All Organisms → cellular organisms → Bacteria	1950	Open in IMG/M
(restricted) 3300031150\|Ga0255311_1049936	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	882	Open in IMG/M
(restricted) 3300031150\|Ga0255311_1078142	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	707	Open in IMG/M
(restricted) 3300031150\|Ga0255311_1086416	Not Available	673	Open in IMG/M
(restricted) 3300031197\|Ga0255310_10067452	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	943	Open in IMG/M
(restricted) 3300031197\|Ga0255310_10074298	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla	899	Open in IMG/M
(restricted) 3300031197\|Ga0255310_10075006	All Organisms → cellular organisms → Bacteria	895	Open in IMG/M
3300031229\|Ga0299913_10236756	All Organisms → cellular organisms → Bacteria	1808	Open in IMG/M
3300031455\|Ga0307505_10281162	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	778	Open in IMG/M
3300031962\|Ga0307479_10104123	All Organisms → cellular organisms → Bacteria	2760	Open in IMG/M
3300032174\|Ga0307470_10014602	All Organisms → cellular organisms → Bacteria → Proteobacteria	3368	Open in IMG/M
3300032180\|Ga0307471_100686054	All Organisms → cellular organisms → Bacteria	1188	Open in IMG/M
3300032421\|Ga0310812_10050673	All Organisms → cellular organisms → Bacteria	1597	Open in IMG/M
3300032770\|Ga0335085_10000311	All Organisms → cellular organisms → Bacteria	145244	Open in IMG/M
3300033433\|Ga0326726_10023284	All Organisms → cellular organisms → Bacteria	5384	Open in IMG/M
3300033480\|Ga0316620_10831843	Not Available	888	Open in IMG/M
3300033486\|Ga0316624_10318879	All Organisms → cellular organisms → Bacteria	1268	Open in IMG/M
3300033513\|Ga0316628_100801112	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1242	Open in IMG/M
3300034817\|Ga0373948_0098501	All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium	686	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	87.84%
Host-Associated	Host-Associated	12.16%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	70.95%
Aquatic	Environmental → Aquatic	16.89%
Plants	Host-Associated → Plants	12.16%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	67.57%
Rhizoplane	Host-Associated → Plants → Rhizoplane	9.46%
Sediment	Environmental → Aquatic → Sediment	7.43%
Freshwater	Environmental → Aquatic → Freshwater	5.41%
Marine	Environmental → Aquatic → Marine	4.05%
Cave	Environmental → Terrestrial → Cave	2.70%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.70%
Peat	Environmental → Terrestrial → Peat	0.68%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	39.86%
Loam	Environmental → Terrestrial → Soil → Loam	15.54%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	7.43%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	7.43%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	7.43%
Sand	Environmental → Terrestrial → Soil → Sand	4.73%
Wetlands	Environmental → Aquatic → Marine → Wetlands	4.05%
Sediment	Environmental → Aquatic → Freshwater → Sediment	2.70%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	2.70%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	2.03%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.35%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.35%
Soil	Host-Associated → Plants → Rhizosphere → Soil	1.35%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.68%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.68%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.68%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	27.03%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	10.14%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	7.43%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	7.43%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	7.43%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	6.76%
Unclassified	Environmental → Terrestrial → Soil → Sand → Unclassified	4.73%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	4.05%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.38%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	2.70%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	2.70%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	2.70%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.03%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	2.03%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	1.35%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.35%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.35%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	1.35%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.68%
Contaminated	Environmental → Aquatic → Freshwater → Groundwater → Contaminated	0.68%
Uranium Contaminated	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated	0.68%
Unclassified	Environmental → Terrestrial → Soil → Loam → Unclassified	0.68%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.68%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.68%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	11.49%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	8.11%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	7.43%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	4.73%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.73%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	4.05%
Sandy Soil	Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil	4.05%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	3.38%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	3.38%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	2.70%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	2.70%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	2.70%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	2.70%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	2.03%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.03%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	2.03%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	2.03%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	2.03%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	1.35%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.35%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.35%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	1.35%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	1.35%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.35%
Microbial Mat On Rocks	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks	1.35%
Bio-Ooze	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze	1.35%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.35%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.68%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.68%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater	0.68%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.68%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.68%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.68%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil	0.68%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.68%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	0.68%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.68%
Soil	Environmental → Terrestrial → Soil → Loam → Unclassified → Soil	0.68%
Groundwater Sand	Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand	0.68%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.68%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.68%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere	0.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.68%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.68%
Rhizosphere Soil	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil	0.68%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.68%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000443	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly	Environmental	Open in IMG/M
3300000574	Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m	Environmental	Open in IMG/M
3300000596	Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300001431	Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly	Environmental	Open in IMG/M
3300002886	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm	Environmental	Open in IMG/M
3300002914	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm	Environmental	Open in IMG/M
3300003324	Sugarcane bulk soil Sample H2	Environmental	Open in IMG/M
3300003349	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM	Host-Associated	Open in IMG/M
3300003502	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM	Host-Associated	Open in IMG/M
3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300003994	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2	Environmental	Open in IMG/M
3300004058	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1	Environmental	Open in IMG/M
3300004062	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D2	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2	Host-Associated	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated	Open in IMG/M
3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Environmental	Open in IMG/M
3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Environmental	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005610	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3	Environmental	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005875	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101	Environmental	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated	Open in IMG/M
3300006574	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300009087	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009089	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG	Environmental	Open in IMG/M
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental	Open in IMG/M
3300009795	Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_40_50	Environmental	Open in IMG/M
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300011414	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2	Environmental	Open in IMG/M
3300011423	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2	Environmental	Open in IMG/M
3300012034	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2	Environmental	Open in IMG/M
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012912	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300014321	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1	Environmental	Open in IMG/M
3300014884	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300017927	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4	Environmental	Open in IMG/M
3300017930	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5	Environmental	Open in IMG/M
3300017939	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG	Environmental	Open in IMG/M
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental	Open in IMG/M
3300017973	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG	Environmental	Open in IMG/M
3300017997	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex	Environmental	Open in IMG/M
3300018000	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex	Environmental	Open in IMG/M
3300018028	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex	Environmental	Open in IMG/M
3300018063	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2	Environmental	Open in IMG/M
3300018076	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex	Environmental	Open in IMG/M
3300018084	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1	Environmental	Open in IMG/M
3300018422	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T	Environmental	Open in IMG/M
3300018429	Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T	Environmental	Open in IMG/M
3300019458	Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG	Environmental	Open in IMG/M
3300019487	White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG	Environmental	Open in IMG/M
3300019865	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1	Environmental	Open in IMG/M
3300019879	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2	Environmental	Open in IMG/M
3300020060	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2	Environmental	Open in IMG/M
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental	Open in IMG/M
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental	Open in IMG/M
3300021073	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo	Environmental	Open in IMG/M
3300021080	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo	Environmental	Open in IMG/M
3300021081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo	Environmental	Open in IMG/M
3300021086	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300022533	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)	Environmental	Open in IMG/M
3300023057	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6	Environmental	Open in IMG/M
3300023072	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6	Environmental	Open in IMG/M
3300025160	Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2	Environmental	Open in IMG/M
3300025165	Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1	Environmental	Open in IMG/M
3300025324	Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)	Environmental	Open in IMG/M
3300025535	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes)	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025957	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes)	Environmental	Open in IMG/M
3300025962	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 (SPAdes)	Environmental	Open in IMG/M
3300026005	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 (SPAdes)	Environmental	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300026102	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 (SPAdes)	Environmental	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026351	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-05-B	Environmental	Open in IMG/M
3300026508	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-A	Environmental	Open in IMG/M
3300026514	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B	Environmental	Open in IMG/M
3300026535	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq)	Environmental	Open in IMG/M
3300027651	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)	Environmental	Open in IMG/M
3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes)	Host-Associated	Open in IMG/M
3300027775	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)	Environmental	Open in IMG/M
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300028792	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S	Environmental	Open in IMG/M
3300028811	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149	Environmental	Open in IMG/M
3300030006	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67	Environmental	Open in IMG/M
3300031150 (restricted)	Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4	Environmental	Open in IMG/M
3300031197 (restricted)	Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1	Environmental	Open in IMG/M
3300031229	Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38	Environmental	Open in IMG/M
3300031455	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S	Environmental	Open in IMG/M
3300031962	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515	Environmental	Open in IMG/M
3300032174	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032421	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3	Environmental	Open in IMG/M
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300033480	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B	Environmental	Open in IMG/M
3300033486	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A	Environmental	Open in IMG/M
3300033513	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C	Environmental	Open in IMG/M
3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.44
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.44
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F048660

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
F12B_107928032	3300000443	Soil	MKRASIGLGILVTFFLLAMFLMADAEVQPLDDTPVLTSASSAR*
JGI1357J11328_102124222	3300000574	Groundwater	MKRASIGLGILVTFFILAMFLMADAEVTPVDDPALISASAPAR*
KanNP_Total_noBrdU_T14TCDRAFT_10230963	3300000596	Soil	GLGILVTFFLLAMFLMADAEVQPLDDTPVLTSASSAR*
JGI10216J12902_1065069702	3300000956	Soil	MKRASIGLGILVTFFLLAMFLMADAEVQPVDDTPVLTSTSSGR*
F14TB_1001042313	3300001431	Soil	MKRASIGLGILVTFFLLAMFLMADAEVQPQDDTPVLTSASSAR*
JGI25612J43240_10207382	3300002886	Grasslands Soil	MKRATIGFGVLVTFFLLAMFLMADAEVPTVDDTAVVTSTSAR*
JGI25617J43924_103618811	3300002914	Grasslands Soil	MKRATIGFGVLVTFFLLAMFLMADAEVPPVDDTAVVTSTAAR*
soilH2_100198318	3300003324	Sugarcane Root And Bulk Soil	MKRATIGLGILVTFFLLAMFLMADAEVPAVNDAAVVNTSTAR*
JGI26129J50193_10081533	3300003349	Arabidopsis Thaliana Rhizosphere	RMKRASIGLGILVTFFLLAMFLMADAEVQPLDDSPVLTSSPSAR*
JGI26143J51219_10084282	3300003502	Arabidopsis Thaliana Rhizosphere	MKRASIGLGILVTFFLLAMFLMADAEVQPLDDSPVLTSSPSAR*
JGI25405J52794_101362152	3300003911	Tabebuia Heterophylla Rhizosphere	RMKRASIGLGILVTFFLLAMFLMADAEVQPLDDPSVLTTSPSGH*
Ga0055435_100101983	3300003994	Natural And Restored Wetlands	MKRASIGLGILITFFLLAIFLMADAEVTPVDDPAMVSTSAPAR*
Ga0055498_100301611	3300004058	Natural And Restored Wetlands	MKRASIGLGILITFFLLAIFLMADAEVTPVDAPAMISTSAPAR*
Ga0055500_100116071	3300004062	Natural And Restored Wetlands	MKRASIGLGILITFFLLAIFLMADAEVTPVDDPAMISTSAPAR*
Ga0063356_1000444514	3300004463	Arabidopsis Thaliana Rhizosphere	MKRASIGLGILVTFFILAMFLMADAEVAPVDDPALISASAPAR*
Ga0063356_1000807725	3300004463	Arabidopsis Thaliana Rhizosphere	MKRASIGLGILVTFFLLAMFLMADAEVPAVDDAAVVSTSAAR*
Ga0062595_1016018542	3300004479	Soil	MKRASIGFGIIVTFFLLAMFLMADAEVTPVDDPALVSASAPAR*
Ga0065704_104853982	3300005289	Switchgrass Rhizosphere	MKRVSIGFGIIITFFILAMFLMADAEVTPVDDPALMSTSAPAR*
Ga0070690_1000341704	3300005330	Switchgrass Rhizosphere	MKRASIGLGILVTFFLLAMFLMADAEVPAVDDTAVVTSTSAR*
Ga0066388_1003225263	3300005332	Tropical Forest Soil	MKRASIGLGIFMIFFLLAMFLMADAEVAPVDDPAVVSTSASAR*
Ga0068868_1000964102	3300005338	Miscanthus Rhizosphere	MKRASIGFGIIVTFFLLAMFLMADAEVPAVDDAAVVSTSAAR*
Ga0070691_100107403	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	MKRATIGLGVLVTFFLLAMFLMADAEVPPVDDAAVVTSTAAR*
Ga0070691_100143911	3300005341	Corn, Switchgrass And Miscanthus Rhizosphere	SIGLGILVTFFLLAMFLMADAEVQPLDDSPVLTSSPSAR*
Ga0070703_102182772	3300005406	Corn, Switchgrass And Miscanthus Rhizosphere	MKRATIGFGVLVTFFLLAMFLMADAEVPTVDDTAVVTSTAAR*
Ga0070713_1005140222	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MKRATIGFGVLVTFFLLAMFLMADAEVPAVDDTAVVTSTSAR*
Ga0070711_1004148443	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	MKRATIGFGVLVTFFLLAMFLMADAEVPAVDDTAVVTSTAAR*
Ga0070708_1000588612	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	MKRVSIGLGILVTFFLLAMLLMVDAEVPPVNEPAVTTDAAAR*
Ga0070707_1016761202	3300005468	Corn, Switchgrass And Miscanthus Rhizosphere	MKRASIGLGILVTFFLLAMFLMADAEVTPVDDPALISASAPAR*
Ga0070741_100020282	3300005529	Surface Soil	MKRLSIGLGILVMFFVVAMFLMADAEVPSAEDAAVISTSAPAR*
Ga0070696_1003104483	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	MKRATIGFGVLVTFFLLAMFLMADAEVSTVDDTAVVTSTSAR*
Ga0070763_108759661	3300005610	Soil	MKRASIGLGILVIFFLLAMFLMADAEVQPVEDTPVVTTSAPAR*
Ga0066905_1000128253	3300005713	Tropical Forest Soil	MKRASIGLGILVTFFLLAMFLMADAEIQPLDDTPVLTSTPSAR*
Ga0075293_10019633	3300005875	Rice Paddy Soil	MKRASIGLGVLVTFFLLAMFLMADAEVAPPDSPTVTTSAAAR*
Ga0081455_100005063	3300005937	Tabebuia Heterophylla Rhizosphere	MKRASIGLGILVTFFLLAMFLMADAEVQPLDDPSVLTTSPSGH*
Ga0081455_107617381	3300005937	Tabebuia Heterophylla Rhizosphere	MKRVSIGLGILMTFFFLAMFLMADAEIPAASDPVAAADATAR*
Ga0081539_104086742	3300005985	Tabebuia Heterophylla Rhizosphere	MKRASIGLGILVTFFLLAMFLMADAEVPAVDDAAVISTSTAR*
Ga0074056_108389612	3300006574	Soil	MKRATIGFGVLVTFFLLAMFLMADAEVPAVDDTVVVTSTAAR*
Ga0075421_1003441053	3300006845	Populus Rhizosphere	MKRASIGLGILVTFFLLAMFLMADAEVTPVDDPALISASTPAR*
Ga0105107_106397082	3300009087	Freshwater Sediment	MKRASIGFGILVTFFILAMFLMADAEVTPVDDPALISASSPAR*
Ga0099830_101211862	3300009088	Vadose Zone Soil	MKRVSIGLGILVTFFLLAMLLMVDAEVPPVNEPVVTTGAAAR*
Ga0099828_111926312	3300009089	Vadose Zone Soil	MKRATIGFGVLVTFFLLAMFLMADAEVPPVDDTAVVT
Ga0099827_112706152	3300009090	Vadose Zone Soil	MKRVSIGLGILVTFFLLAMFLMVDAEVPPVNEPAVTTGAAAR*
Ga0105059_10413102	3300009795	Groundwater Sand	MKRVSIGLGILVTFFLLAMLLMVDAEVSPVSDPMVTTGAAAR*
Ga0126382_104392693	3300010047	Tropical Forest Soil	MKRASIGLGILVTFFLLAMFLMADAEIQPLDNTPVLTSTPSAR*
Ga0126377_135096462	3300010362	Tropical Forest Soil	MKRASIGLGIFMIFFLLAMFLMADAEVAPVDDPTIVSTSAPAR*
Ga0126383_122202432	3300010398	Tropical Forest Soil	MKRASIGLGIFMIFFLLAMFLMADAEVAPVDDPAVVSTSVSAR*
Ga0134121_108989252	3300010401	Terrestrial Soil	MKRATIGFGVLVTFFLLAMFLMAAAEVSTVDDTAVVTSTSAR*
Ga0137442_10518212	3300011414	Soil	MKRASIGFGILVTFFILAMFLMADAEVTPVDDPALISTSAPAR*
Ga0137436_12136022	3300011423	Soil	MKRASIGFGILVTFFILAMFLMADAEVTPVDDPALISASAPAR*
Ga0137453_10352612	3300012034	Soil	MKRASIGLGILVTFFILAMFLMADAEVTPVDDPALISTSAPAR*
Ga0137382_111023721	3300012200	Vadose Zone Soil	MKRATIGFGVLVTFFLLAMFLMADAEVPTVDDAAVVTSTSAR*
Ga0137363_107269251	3300012202	Vadose Zone Soil	MKRATIGFGVLVTFFLLAMFLMADAEVPTVDDTAV
Ga0137361_117053332	3300012362	Vadose Zone Soil	FGVLVTFFLLAMFLMADAEVPTVDDTAVVTSTSAR*
Ga0157306_102180211	3300012912	Soil	ASIGLGILVTFFLLAMFLMADAEVQPLDDSPVLTSSPSAR*
Ga0137396_109286932	3300012918	Vadose Zone Soil	MKRATIGFGVLVTFFLLAMFLMADAEVPPVDDTAVVTSTSAR*
Ga0137394_101330733	3300012922	Vadose Zone Soil	MKRASIGLGILVTFFLLAMFLMADAEVTPVDDPALISASAPTR*
Ga0137404_102418342	3300012929	Vadose Zone Soil	MKRASIGLGILVTFFLLAMFLMADAEVTPVDDPALI*
Ga0137404_103533741	3300012929	Vadose Zone Soil	HPRMKRASIGLGILVTFFLLAMFLMADAEVTPVDDPALVSASAPAR*
Ga0153915_102868463	3300012931	Freshwater Wetlands	MKRATIGLGVLVIFFLLAMFLMADAEVPPVDDTAVVASTAAR*
Ga0164302_111629752	3300012961	Soil	MKRASIGLGILVTSFLLAMFLMADAEVPAVDDAAVVSTSAAR*
Ga0075353_11053793	3300014321	Natural And Restored Wetlands	ASIGLGILITFFLLAIFLMADAEVTPVDDPAMISTSAPAR*
Ga0180104_10029154	3300014884	Soil	MKRASIGLGILVTFFILAMCLMADAEVTPVDDPALISASAPAR*
Ga0132258_105699923	3300015371	Arabidopsis Rhizosphere	MKRATIGFGVLVTFFLLAMFLMADAEVPPVDDTAVVINTAAR*
Ga0132256_1024963131	3300015372	Arabidopsis Rhizosphere	MKRATIGFGILVTFFLLAMFLMADAEVPPVDDTAVV
Ga0187824_100733863	3300017927	Freshwater Sediment	MKRATIGFGILVTFFLLAMFLMADAEVPAVDDTAVVTSTAAR
Ga0187825_102099052	3300017930	Freshwater Sediment	MKRATIGFGILVTFFLLAMFLMADAEVPPVDDTAVVTSTAAR
Ga0187775_102634542	3300017939	Tropical Peatland	MKRASIGLGILVTFFLLAMFLMADAEVQPADDSPVLTSTSAAR
Ga0187779_110163001	3300017959	Tropical Peatland	MKRAWIGLGILITFFILAMFLMADADVQPAEDSPVVSSAPAR
Ga0187780_100849143	3300017973	Tropical Peatland	MKRAWIGFGILITFFILAMFLMADAEVQPVDDTPVVSSAPAR
Ga0184610_10051555	3300017997	Groundwater Sediment	MKRASIGLGILVTFFILAMFLMADAEVTPVDDPALISASAPAR
Ga0184604_100486173	3300018000	Groundwater Sediment	MKRASIGLGILVTFFLLAMFLMADAEVSPVDDPALISASAPAR
Ga0184608_103259732	3300018028	Groundwater Sediment	HPRMKRASIGLGILVTFFILAMFLMADAEVTPVDDPALISASAPAR
Ga0184637_103021822	3300018063	Groundwater Sediment	MKRVSIGLGILVTFFLLAMFLMVDAEVPAVSDPVVTTGSVAR
Ga0184609_102831383	3300018076	Groundwater Sediment	DHPRMKRASIGLGILVTFFILAMFLMADAEVTPVDDPALISASAPAR
Ga0184629_100557574	3300018084	Groundwater Sediment	SIGLGILVTFFIRAMFLMADAEVTPVDDPALISASAPAR
Ga0184629_101080313	3300018084	Groundwater Sediment	MKRASIGFSILVTFFILAMFLMADAEVTPVDDPALISTSAPAR
Ga0190265_100322113	3300018422	Soil	MKRASIGLGILVTFFILAMFLMADAEVTPVDDPALISASSPAR
Ga0190265_100380874	3300018422	Soil	MKRASIGLGILVTFFLLAMFLMADAEVVPLDDPAVHSTSAPAR
Ga0190265_133363842	3300018422	Soil	MKRASIGFGILVTFFILAMFLMADAEVTPVDDPALVSTSAPAR
Ga0190272_111422552	3300018429	Soil	MKRASIGLGILVTFFILAMFLMADAEVTPVDDPALISASAP
Ga0190272_117545592	3300018429	Soil	MKRASIGLGILVTFFILAMFLMADAEVTPVDDPALVSTSAPAR
Ga0190272_132592942	3300018429	Soil	MKRASIGLGILVTFFLLAMFLMADAEVTPVDDPALISASAPAR
Ga0187892_1000814512	3300019458	Bio-Ooze	MKRASIGLGILVTFFLLAMFLMADAEVTPVDDPALISASTPAR
Ga0187892_100642452	3300019458	Bio-Ooze	MKRVSIGLGILVTFFLLAMFLMVDAEVPPVSDPVVTTGAAAR
Ga0187893_106657381	3300019487	Microbial Mat On Rocks	PRMKRASIGLGILVTFFLLAMFLMADAEVTPVDDPALISASTPAR
Ga0187893_109720462	3300019487	Microbial Mat On Rocks	MKRAWIGLGILVTFFVLAMFLMADAEVTPLDDPALISPSSLPR
Ga0193748_10092302	3300019865	Soil	MKRATIGFGVLVTFFLLAMFLMADAEVPTVDDTAVVTSTSAR
Ga0193723_10122354	3300019879	Soil	MKRASIGFGIIVTFFLLAMFLMADAEVPPVDDPALVSASAPAR
Ga0193717_10965072	3300020060	Soil	MKRASIGFGILVTFFILAMFLMADAEVTPVDDPALISASAPAR
Ga0210403_107692072	3300020580	Soil	MKRASIGLGILVIFFLLAMFLMADAEVQPVEDTPVVTTSAPAR
Ga0210399_100251616	3300020581	Soil	MKRASIGLGILVIFFLLAMLLMADAEVQPVEDTPVVTTSAPAR
Ga0210378_102227103	3300021073	Groundwater Sediment	GDHPRMKRASIGLGILVTFFILAMFLMADAEVTPVDDPALISASAPAR
Ga0210382_100597644	3300021080	Groundwater Sediment	IGLGILVTFFLLAMFLMADAEVSPVDDPALISASAPAR
Ga0210379_103852502	3300021081	Groundwater Sediment	RASIGLGILVTFFILAMFLMADAEVTPVDDPALISASAPAR
Ga0179596_103630992	3300021086	Vadose Zone Soil	MKRATIGFGVLVTFFLLAMFLMADAEVPPVDDTAVVTSTAAR
Ga0210400_114899542	3300021170	Soil	MKRASIGLGILVIFFLLAMLLMADAEVQPVEDTPVVT
Ga0182009_100164892	3300021445	Soil	MKRASIGLGILVTFFLLAMFLMADAEVPAVDDAAVVSTSAAR
Ga0126371_115595012	3300021560	Tropical Forest Soil	MKRASIGLGIFMIFFLLAMFLMADAEVAPVDDPAVVSTSASAR
Ga0242662_102640671	3300022533	Soil	MKRATIGFGVLVTFFLLAMFLMADAEVPAVDDTAVVTGTAAR
Ga0247797_10663282	3300023057	Soil	MKRASIGLGILVTFFLLAMFLMADAEVQPLDDSPVLTSSPSAR
Ga0247799_10016251	3300023072	Soil	RPRMKRASIGLGILVTFFLLAMFLMADAEVQPLDDSPVLTSSPSAR
Ga0209109_101356932	3300025160	Soil	MKRASIGLGILVTFFILAMFLMADAEVTPVDDPALFSASAPAR
Ga0209108_100887413	3300025165	Soil	MKRASIGLGILVTFFILAMFLMADAEVTPLDDSAVVSTSAPAR
Ga0209108_103590032	3300025165	Soil	MKRVSIGLGILVTFFLLAMFLMVDAEVPSVNDPVVTTGAAAR
Ga0209640_104624882	3300025324	Soil	MKRVSIGLGILVTFFLLAMFLMVDAEVPPVNDSVVTTGAAAR
Ga0207423_10322182	3300025535	Natural And Restored Wetlands	MKRASIGLGILITFFLLAIFLMADAEVTPVDDPAMVSTSAPAR
Ga0207642_103774191	3300025899	Miscanthus Rhizosphere	RMKRASIGFGIIVTFFLLAMFLMADAEVTPVDDPALVSASAPAR
Ga0207684_1000086712	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MKRVSIGLGILVTFFLLAMLLMVDAEVPPVNEPAVTTDAAAR
Ga0207684_101040443	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MKRATIGFGVLVTFFLLAMFLMADAEVPTVDDTAVVTSTAAR
Ga0207707_102376112	3300025912	Corn Rhizosphere	MKRASIGLGILVTFFILAMFLMADAEVAPVDDPALISASAPAR
Ga0207707_108915782	3300025912	Corn Rhizosphere	MKRASIGFGIIVTFFLLAMFLMADAEVTPVDDPALVSASAPAR
Ga0207652_111267131	3300025921	Corn Rhizosphere	MKRASIGLGILVTFFILAMFLMADAEVAPVDDPALISASAPA
Ga0207686_112364132	3300025934	Miscanthus Rhizosphere	MKRATIGFGVLVTFFLLAMFLMADAEVSTVDDTAVVTSTSAR
Ga0210089_10513772	3300025957	Natural And Restored Wetlands	MKRASIGFAILITFFILAMFLMADAEVTPVDDPALTSTSAPAR
Ga0210070_10262192	3300025962	Natural And Restored Wetlands	MKRASIGLGILITFFLLAIFLMADAEVTPVDDPAMISTSAPAR
Ga0208285_10085752	3300026005	Rice Paddy Soil	MKRATIGLGVLVTFFLLAMFLMADAEVPPVDDAAVVTSTAAR
Ga0207708_110940581	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	MKRASIGFGIIVTFFLLAMFLMADAEVTPVDDPAL
Ga0208914_10448911	3300026102	Natural And Restored Wetlands	KRASIGLGILITFFLLAIFLMADAEVTPVDDPAMISTSAPAR
Ga0207683_118964041	3300026121	Miscanthus Rhizosphere	MKRASIGLGILVTFFLLAMFLMADAEVPAVDDAAVVSTSAA
Ga0257170_10220891	3300026351	Soil	PRMKRASIGLGILVTFFILAMFLMADAEVTPVDDPALISASAPAR
Ga0257161_10728481	3300026508	Soil	IGFGVLVTFFLLAMFLMADAEVPTVDDTAVVTSTSAR
Ga0257168_10013594	3300026514	Soil	MKRATIGFGVLVTFFLLAMFLMADAEVPTVDDTAVVTGTAAR
Ga0256867_101838952	3300026535	Soil	MKRASIGLGILVTFFILAMFLMADAEVAPVDEPALSSAGAPTR
Ga0209217_12147621	3300027651	Forest Soil	MKRATIGFGVLVTFFLLAMFLMADAEVPTVDDTAVVTSTSA
Ga0209971_10810111	3300027682	Arabidopsis Thaliana Rhizosphere	MKRASIGLGILVTFFLLAMFLMADAEVPAVDDAAVVSTS
Ga0209177_101497951	3300027775	Agricultural Soil	MKRATIGLGILVTFFLLAMFLMADAEVPAVNDAAVVNTSTAR
Ga0209590_107106982	3300027882	Vadose Zone Soil	MKRVSIGLGILVTFFLLAMFLMVDAEVPPVNEPAVTTGAAAR
Ga0307504_101630842	3300028792	Soil	MKRVSIGLGILVTFFLLAMLLMVDAEVPPVNDPVVTTGAAAR
Ga0307292_101413553	3300028811	Soil	MKRASIGLGILVTFFLLAMFLMADAEVSPVDDPALISASAP
Ga0299907_101466824	3300030006	Soil	MKRASIGLGILVTFFILAMFLMADAEVAPVDEPALSSASAPAR
(restricted) Ga0255311_10499362	3300031150	Sandy Soil	MKRLSIGLGILVTFFLLAMLLMADAEVPSVSDSAVVTTSTPAR
(restricted) Ga0255311_10781422	3300031150	Sandy Soil	MKRASIGFGIIITFFILAMFLMADAEVTPVDDPALMSTSAPAR
(restricted) Ga0255311_10864161	3300031150	Sandy Soil	PGDHSRMKRASIGFGILVTFFILAMFLMADAEVTPVDDPALISASAPAR
(restricted) Ga0255310_100674522	3300031197	Sandy Soil	MKRATIGFGILVTFFLLAMFLMADAEVPVVDDTAVVTSTAAR
(restricted) Ga0255310_100742982	3300031197	Sandy Soil	MKRLSIGLGILVTFFLLAILLMADAEVPSVGDSAVVTTSAPAR
(restricted) Ga0255310_100750061	3300031197	Sandy Soil	GLGILVTFFILAMFLMADAEVTPLDDAAVVSTSAPAR
Ga0299913_102367563	3300031229	Soil	MKRASIGLGILVTFFILAMFLMADAEVAPVDEPALSSASAPTR
Ga0307505_102811622	3300031455	Soil	MKRASIAFGILVTFFILAMFLMADAEVSPVDDPALISASSPAR
Ga0307479_101041236	3300031962	Hardwood Forest Soil	MKRASIGLGILVIFFLLAMFLMADADVQPVEDTPVVTTSAPAR
Ga0307470_100146023	3300032174	Hardwood Forest Soil	MKRASIGFGILVTFFILAMFLMADAEVTPVDDPALISTSAPAR
Ga0307471_1006860542	3300032180	Hardwood Forest Soil	MKRASIGLGILVTFFLLAMFLMADAEVQPLDDTPVLTSSPSAR
Ga0310812_100506732	3300032421	Soil	MKRATIGFGVLVTFFLLAMFLMADAEVPPVDDTAVVTNTSAR
Ga0335085_1000031126	3300032770	Soil	MKRASIGLGVLVTFFLLAMFLMADAEVQPVEDTPVLTSSSPAR
Ga0326726_100232845	3300033433	Peat Soil	MKRATIGLGVLVTFFLLAMFLMADAEVPPVDDTAVVTSTAAR
Ga0316620_108318432	3300033480	Soil	MKRATIGLGVLVIFFLLAMFLMADAEVPPVDDTAVVASTAAR
Ga0316624_103188792	3300033486	Soil	MKRATIGLGVLVTFFLLAMFLMADAEVPPVDDAAVVTSTAAAR
Ga0316628_1008011121	3300033513	Soil	MKRATIGLGVLVIFFLLAMFLMADAEVPPVDDTAVVAS
Ga0373948_0098501_76_204	3300034817	Rhizosphere Soil	MKRATIGFGVLVTFFLLAMFLMADAEVPPVDDTAVVTSTSAR

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign