Metagenome / Metatranscriptome Family F050382

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F050382
Family Type	Metagenome / Metatranscriptome
Number of Sequences	145
Average Sequence Length	38 residues
Representative Sequence	NIQISNKIKSQLFGILNFGHCDLFGICVLLFEIF
Number of Associated Samples	57
Number of Associated Scaffolds	145

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	1.41 %
% of genes near scaffold ends (potentially truncated)	96.55 %
% of genes from short scaffolds (< 2000 bps)	92.41 %
Associated GOLD sequencing projects	51
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (63.448 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment (20.000 % of family members)
Environment Ontology (ENVO)	Unclassified (41.379 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (42.759 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 51.61% β-sheet: 0.00% Coil/Unstructured: 48.39%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.37
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 145 Family Scaffolds
PF00005	ABC_tran	3.45
PF01568	Molydop_binding	2.07
PF00293	NUDIX	2.07
PF00155	Aminotran_1_2	1.38
PF03473	MOSC	1.38
PF06808	DctM	1.38
PF00158	Sigma54_activat	1.38
PF00441	Acyl-CoA_dh_1	1.38
PF01040	UbiA	1.38
PF09837	DUF2064	1.38
PF02769	AIRS_C	1.38
PF02653	BPD_transp_2	1.38
PF00072	Response_reg	1.38
PF00120	Gln-synt_C	1.38
PF13458	Peripla_BP_6	1.38
PF06750	DiS_P_DiS	1.38
PF03992	ABM	1.38
PF00528	BPD_transp_1	1.38
PF04879	Molybdop_Fe4S4	1.38
PF00266	Aminotran_5	1.38
PF01925	TauE	0.69
PF00873	ACR_tran	0.69
PF00850	Hist_deacetyl	0.69
PF00549	Ligase_CoA	0.69
PF02775	TPP_enzyme_C	0.69
PF01636	APH	0.69
PF06684	AA_synth	0.69
PF02371	Transposase_20	0.69
PF01937	ARMT1-like_dom	0.69
PF00675	Peptidase_M16	0.69
PF07702	UTRA	0.69
PF05036	SPOR	0.69
PF01256	Carb_kinase	0.69
PF00591	Glycos_transf_3	0.69
PF11059	DUF2860	0.69
PF13502	AsmA_2	0.69
PF00724	Oxidored_FMN	0.69
PF00474	SSF	0.69
PF02597	ThiS	0.69
PF01121	CoaE	0.69
PF01869	BcrAD_BadFG	0.69
PF01891	CbiM	0.69
PF08544	GHMP_kinases_C	0.69
PF06245	DUF1015	0.69
PF10589	NADH_4Fe-4S	0.69
PF00571	CBS	0.69
PF02347	GDC-P	0.69
PF08545	ACP_syn_III	0.69
PF00027	cNMP_binding	0.69
PF13507	GATase_5	0.69
PF01558	POR	0.69
PF00378	ECH_1	0.69
PF11136	DUF2889	0.69
PF02782	FGGY_C	0.69
PF02575	YbaB_DNA_bd	0.69
PF01799	Fer2_2	0.69
PF08352	oligo_HPY	0.69
PF01252	Peptidase_A8	0.69
PF12704	MacB_PCD	0.69
PF01855	POR_N	0.69
PF00198	2-oxoacid_dh	0.69
PF02515	CoA_transf_3	0.69
PF07977	FabA	0.69
PF00226	DnaJ	0.69
PF06421	LepA_C	0.69
PF01168	Ala_racemase_N	0.69
PF02737	3HCDH_N	0.69
PF13462	Thioredoxin_4	0.69
PF03129	HGTP_anticodon	0.69
PF02754	CCG	0.69
PF01472	PUA	0.69
PF00588	SpoU_methylase	0.69
PF04560	RNA_pol_Rpb2_7	0.69
PF02954	HTH_8	0.69
PF00180	Iso_dh	0.69
PF01565	FAD_binding_4	0.69
PF00342	PGI	0.69
PF13187	Fer4_9	0.69
PF14574	RACo_C_ter	0.69
PF00276	Ribosomal_L23	0.69
PF17147	PFOR_II	0.69
PF01208	URO-D	0.69
PF03717	PBP_dimer	0.69
PF01070	FMN_dh	0.69
PF13185	GAF_2	0.69
PF00817	IMS	0.69
PF01676	Metalloenzyme	0.69
PF13534	Fer4_17	0.69
PF01475	FUR	0.69
PF01478	Peptidase_A24	0.69
PF00383	dCMP_cyt_deam_1	0.69
PF01554	MatE	0.69
PF13192	Thioredoxin_3	0.69
PF04015	DUF362	0.69
PF01261	AP_endonuc_2	0.69
PF08534	Redoxin	0.69
PF06253	MTTB	0.69
PF02738	MoCoBD_1	0.69
PF01699	Na_Ca_ex	0.69
PF03330	DPBB_1	0.69
PF12844	HTH_19	0.69
PF01039	Carboxyl_trans	0.69
PF13173	AAA_14	0.69

COG ID	Name	Functional Category	% Frequency in 145 Family Scaffolds
COG1989	Prepilin signal peptidase PulO (type II secretory pathway) or related peptidase	Cell motility [N]	4.14
COG0123	Acetoin utilization deacetylase AcuC or a related deacetylase	Secondary metabolites biosynthesis, transport and catabolism [Q]	1.38
COG0597	Lipoprotein signal peptidase	Cell wall/membrane/envelope biogenesis [M]	1.38
COG1960	Acyl-CoA dehydrogenase related to the alkylation response protein AidB	Lipid transport and metabolism [I]	1.38
COG0042	tRNA-dihydrouridine synthase	Translation, ribosomal structure and biogenesis [J]	0.69
COG0045	Succinyl-CoA synthetase, beta subunit	Energy production and conversion [C]	0.69
COG0063	NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate dehydratase domain	Nucleotide transport and metabolism [F]	0.69
COG0069	Glutamate synthase domain 2	Amino acid transport and metabolism [E]	0.69
COG0074	Succinyl-CoA synthetase, alpha subunit	Energy production and conversion [C]	0.69
COG0085	DNA-directed RNA polymerase, beta subunit/140 kD subunit	Transcription [K]	0.69
COG0089	Ribosomal protein L23	Translation, ribosomal structure and biogenesis [J]	0.69
COG0124	Histidyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.69
COG0166	Glucose-6-phosphate isomerase	Carbohydrate transport and metabolism [G]	0.69
COG0219	tRNA(Leu) C34 or U34 (ribose-2'-O)-methylase TrmL, contains SPOUT domain	Translation, ribosomal structure and biogenesis [J]	0.69
COG0237	Dephospho-CoA kinase	Coenzyme transport and metabolism [H]	0.69
COG0240	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	0.69
COG0247	Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcF	Energy production and conversion [C]	0.69
COG0287	Prephenate dehydrogenase	Amino acid transport and metabolism [E]	0.69
COG0310	ABC-type Co2+ transport system, permease component	Inorganic ion transport and metabolism [P]	0.69
COG0351	Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase	Coenzyme transport and metabolism [H]	0.69
COG0387	Cation (Ca2+/Na+/K+)/H+ antiporter ChaA	Inorganic ion transport and metabolism [P]	0.69
COG0389	Nucleotidyltransferase/DNA polymerase DinP involved in DNA repair	Replication, recombination and repair [L]	0.69
COG0403	Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain	Amino acid transport and metabolism [E]	0.69
COG0407	Uroporphyrinogen-III decarboxylase HemE	Coenzyme transport and metabolism [H]	0.69
COG0423	Glycyl-tRNA synthetase, class II	Translation, ribosomal structure and biogenesis [J]	0.69
COG0441	Threonyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.69
COG0442	Prolyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	0.69
COG0481	Translation elongation factor EF-4, membrane-bound GTPase	Translation, ribosomal structure and biogenesis [J]	0.69
COG0508	Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component	Energy production and conversion [C]	0.69
COG0530	Ca2+/Na+ antiporter	Inorganic ion transport and metabolism [P]	0.69
COG0565	tRNA C32,U32 (ribose-2'-O)-methylase TrmJ or a related methyltransferase	Translation, ribosomal structure and biogenesis [J]	0.69
COG0566	tRNA G18 (ribose-2'-O)-methylase SpoU	Translation, ribosomal structure and biogenesis [J]	0.69
COG0674	Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, alpha subunit	Energy production and conversion [C]	0.69
COG0677	UDP-N-acetyl-D-mannosaminuronate dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	0.69
COG0718	DNA-binding nucleoid-associated protein YbaB/EfbC	Transcription [K]	0.69
COG0730	Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family	Inorganic ion transport and metabolism [P]	0.69
COG0735	Fe2+ or Zn2+ uptake regulation protein Fur/Zur	Inorganic ion transport and metabolism [P]	0.69
COG0764	3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase	Lipid transport and metabolism [I]	0.69
COG0768	Cell division protein FtsI, peptidoglycan transpeptidase (Penicillin-binding protein 2)	Cell cycle control, cell division, chromosome partitioning [D]	0.69
COG0777	Acetyl-CoA carboxylase beta subunit	Lipid transport and metabolism [I]	0.69
COG0825	Acetyl-CoA carboxylase alpha subunit	Lipid transport and metabolism [I]	0.69
COG1003	Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain	Amino acid transport and metabolism [E]	0.69
COG1004	UDP-glucose 6-dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	0.69
COG1014	Pyruvate:ferredoxin oxidoreductase or related 2-oxoacid:ferredoxin oxidoreductase, gamma subunit	Energy production and conversion [C]	0.69
COG1250	3-hydroxyacyl-CoA dehydrogenase	Lipid transport and metabolism [I]	0.69
COG1304	FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomerase	Energy production and conversion [C]	0.69
COG1578	House-cleaning carbohydrate phosphatase, DUF89 family	Defense mechanisms [V]	0.69
COG1748	Saccharopine dehydrogenase, NADP-dependent	Amino acid transport and metabolism [E]	0.69
COG1804	Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases	Lipid transport and metabolism [I]	0.69
COG1902	2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family	Energy production and conversion [C]	0.69
COG1977	Molybdopterin synthase sulfur carrier subunit MoaD	Coenzyme transport and metabolism [H]	0.69
COG2006	Uncharacterized conserved protein, DUF362 family	Function unknown [S]	0.69
COG2048	Heterodisulfide reductase, subunit B	Energy production and conversion [C]	0.69
COG2084	3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase	Lipid transport and metabolism [I]	0.69
COG2104	Sulfur carrier protein ThiS (thiamine biosynthesis)	Coenzyme transport and metabolism [H]	0.69
COG3547	Transposase	Mobilome: prophages, transposons [X]	0.69
COG4198	Uncharacterized conserved protein, DUF1015 family	Function unknown [S]	0.69
COG4231	TPP-dependent indolepyruvate ferredoxin oxidoreductase, alpha subunit	Energy production and conversion [C]	0.69
COG4706	Predicted 3-hydroxylacyl-ACP dehydratase, HotDog domain	Lipid transport and metabolism [I]	0.69
COG4799	Acetyl-CoA carboxylase, carboxyltransferase component	Lipid transport and metabolism [I]	0.69
COG5598	Trimethylamine:corrinoid methyltransferase	Coenzyme transport and metabolism [H]	0.69

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	64.14 %
Unclassified	root	N/A	35.86 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	64.14 %
Unclassified	root	N/A	35.86 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	63.45 %
Unclassified	root	N/A	35.86 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	0.69 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	39.31 %
Unclassified	root	N/A	35.86 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	2.07 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.69 %
Euryarchaeota	phylum	All Organisms → cellular organisms → Archaea → Euryarchaeota	0.69 %
Spirochaetes	phylum	All Organisms → cellular organisms → Bacteria → Spirochaetes	0.69 %

Name	Rank	Taxonomy	Distribution
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	35.17 %
Unclassified	root	N/A	35.86 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	2.07 %
Stenosarchaea group	clade	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group	0.69 %
Spirochaetia	class	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia	0.69 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.69 %

Name	Rank	Taxonomy	Distribution
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	35.17 %
Unclassified	root	N/A	35.86 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.07 %
Methanomicrobia	class	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia	0.69 %
Dehalococcoidia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia	0.69 %
Spirochaetales	order	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.86 %
Desulfobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	12.41 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	6.90 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.07 %
unclassified Dehalococcoidia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia	0.69 %
Spirochaetaceae	family	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae	0.69 %
Desulfovibrionales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales	0.69 %
Syntrophobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales	0.69 %
Methanomicrobia	class	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.86 %
Desulfobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	5.52 %
unclassified Desulfobacterales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales	4.14 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	3.45 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.07 %
Olavius sp. associated proteobacterium Delta 1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1	1.38 %
Deltaproteobacteria bacterium ADurb.Bin002	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.Bin002	0.69 %
Deltaproteobacteria bacterium HGW-Deltaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-13	0.69 %
Alkalispirochaeta	genus	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta	0.69 %
Dehalococcoidia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium	0.69 %
Olavius algarvensis associated proteobacterium Delta 3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis associated proteobacterium Delta 3	0.69 %
Desulfovibrionaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae	0.69 %
Syntrophobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae	0.69 %
Methanomicrobia	class	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.86 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	4.14 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	3.45 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.07 %
unclassified Desulfobacteraceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae	1.38 %
Desulfobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacterium	1.38 %
Olavius sp. associated proteobacterium Delta 1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1	1.38 %
Alkalispirochaeta odontotermitis	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis	0.69 %
Halodesulfovibrio	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Halodesulfovibrio	0.69 %
Desulfococcus	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfococcus	0.69 %
Syntrophobacter	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter	0.69 %
Deltaproteobacteria bacterium ADurb.Bin002	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.Bin002	0.69 %
Deltaproteobacteria bacterium HGW-Deltaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-13	0.69 %
Dehalococcoidia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium	0.69 %
Olavius algarvensis associated proteobacterium Delta 3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis associated proteobacterium Delta 3	0.69 %
Methanomicrobia	class	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.86 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	4.14 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	3.45 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.07 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacterium → environmental samples	1.38 %
Olavius sp. associated proteobacterium Delta 1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1	1.38 %
unclassified Syntrophobacter	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → unclassified Syntrophobacter	0.69 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	0.69 %
Desulfobacteraceae bacterium 4572_89	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium 4572_89	0.69 %
Halodesulfovibrio aestuarii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Halodesulfovibrio → Halodesulfovibrio aestuarii	0.69 %
Desulfococcus multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfococcus → Desulfococcus multivorans	0.69 %
Alkalispirochaeta odontotermitis	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis	0.69 %
Deltaproteobacteria bacterium ADurb.Bin002	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.Bin002	0.69 %
Deltaproteobacteria bacterium HGW-Deltaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-13	0.69 %
Dehalococcoidia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium	0.69 %
Olavius algarvensis associated proteobacterium Delta 3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis associated proteobacterium Delta 3	0.69 %
Methanomicrobia	class	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia	0.69 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	35.86 %
Desulfobacterales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	4.14 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	3.45 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	2.07 %
uncultured Desulfobacterium sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacterium → environmental samples → uncultured Desulfobacterium sp.	1.38 %
Olavius sp. associated proteobacterium Delta 1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1	1.38 %
Syntrophobacter sp. SbD1	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → unclassified Syntrophobacter → Syntrophobacter sp. SbD1	0.69 %
Desulfobacteraceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	0.69 %
Desulfobacteraceae bacterium 4572_89	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium 4572_89	0.69 %
Halodesulfovibrio aestuarii	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Halodesulfovibrio → Halodesulfovibrio aestuarii	0.69 %
Desulfococcus multivorans	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfococcus → Desulfococcus multivorans	0.69 %
Alkalispirochaeta odontotermitis	species	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis	0.69 %
Deltaproteobacteria bacterium ADurb.Bin002	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.Bin002	0.69 %
Deltaproteobacteria bacterium HGW-Deltaproteobacteria-13	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-13	0.69 %
Dehalococcoidia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium	0.69 %
Olavius algarvensis associated proteobacterium Delta 3	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis associated proteobacterium Delta 3	0.69 %
Methanomicrobia	class	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia	0.69 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000242\|TDF_OR_ARG05_123mDRAFT_1092162	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	580	Open in IMG/M
3300001270\|BBAY91_10193147	Not Available	522	Open in IMG/M
3300004023\|Ga0055441_10157853	All Organisms → cellular organisms → Bacteria	613	Open in IMG/M
3300005588\|Ga0070728_10124800	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	1508	Open in IMG/M
3300005588\|Ga0070728_10353718	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	786	Open in IMG/M
3300005588\|Ga0070728_10621382	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	558	Open in IMG/M
3300005588\|Ga0070728_10660307	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	538	Open in IMG/M
3300005589\|Ga0070729_10369995	Not Available	797	Open in IMG/M
3300005589\|Ga0070729_10526020	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	645	Open in IMG/M
3300005590\|Ga0070727_10436232	Not Available	731	Open in IMG/M
3300005590\|Ga0070727_10804820	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1	527	Open in IMG/M
3300005600\|Ga0070726_10150389	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	1200	Open in IMG/M
3300005600\|Ga0070726_10217206	All Organisms → cellular organisms → Bacteria	973	Open in IMG/M
3300005600\|Ga0070726_10640087	Not Available	536	Open in IMG/M
3300005612\|Ga0070723_10589010	Not Available	557	Open in IMG/M
3300005826\|Ga0074477_1681879	All Organisms → cellular organisms → Bacteria	657	Open in IMG/M
3300006467\|Ga0099972_10040566	All Organisms → cellular organisms → Bacteria → Proteobacteria	1470	Open in IMG/M
3300006467\|Ga0099972_10262522	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophobacteraceae → Syntrophobacter → unclassified Syntrophobacter → Syntrophobacter sp. SbD1	586	Open in IMG/M
3300006467\|Ga0099972_10817210	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	812	Open in IMG/M
3300006467\|Ga0099972_10876226	Not Available	564	Open in IMG/M
3300006467\|Ga0099972_11739422	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	598	Open in IMG/M
3300006467\|Ga0099972_12517223	Not Available	581	Open in IMG/M
3300006467\|Ga0099972_12519895	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	677	Open in IMG/M
3300006467\|Ga0099972_13299637	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	669	Open in IMG/M
3300006467\|Ga0099972_13367245	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300006467\|Ga0099972_13544405	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	546	Open in IMG/M
3300007102\|Ga0102541_1437233	All Organisms → cellular organisms → Bacteria	1752	Open in IMG/M
3300009027\|Ga0102957_1265441	Not Available	623	Open in IMG/M
3300009035\|Ga0102958_1261106	Not Available	592	Open in IMG/M
3300009035\|Ga0102958_1328600	Not Available	537	Open in IMG/M
3300009145\|Ga0102961_1102859	Not Available	729	Open in IMG/M
3300009145\|Ga0102961_1182733	All Organisms → cellular organisms → Bacteria → Proteobacteria	578	Open in IMG/M
3300009145\|Ga0102961_1263411	Not Available	503	Open in IMG/M
3300009788\|Ga0114923_10824822	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	705	Open in IMG/M
3300010392\|Ga0118731_101966601	All Organisms → cellular organisms → Bacteria	4653	Open in IMG/M
3300010392\|Ga0118731_104205068	Not Available	684	Open in IMG/M
3300010392\|Ga0118731_104371484	All Organisms → cellular organisms → Bacteria	696	Open in IMG/M
3300010392\|Ga0118731_104843781	All Organisms → cellular organisms → Bacteria	1991	Open in IMG/M
3300010392\|Ga0118731_104846165	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium	717	Open in IMG/M
3300010392\|Ga0118731_105285113	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1350	Open in IMG/M
3300010392\|Ga0118731_106147781	Not Available	530	Open in IMG/M
3300010392\|Ga0118731_106149102	All Organisms → cellular organisms → Bacteria	527	Open in IMG/M
3300010392\|Ga0118731_107450997	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	562	Open in IMG/M
3300010392\|Ga0118731_107652173	Not Available	713	Open in IMG/M
3300010392\|Ga0118731_108347426	Not Available	909	Open in IMG/M
3300010392\|Ga0118731_109809925	Not Available	699	Open in IMG/M
3300010392\|Ga0118731_109921575	Not Available	548	Open in IMG/M
3300010392\|Ga0118731_112051294	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-13	1202	Open in IMG/M
3300010392\|Ga0118731_112676672	All Organisms → cellular organisms → Bacteria	744	Open in IMG/M
3300010392\|Ga0118731_113352834	All Organisms → cellular organisms → Bacteria → Proteobacteria	513	Open in IMG/M
3300010392\|Ga0118731_114429822	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium 4572_89	579	Open in IMG/M
3300010392\|Ga0118731_114950381	All Organisms → cellular organisms → Bacteria → Proteobacteria	2045	Open in IMG/M
3300010430\|Ga0118733_101549925	All Organisms → cellular organisms → Bacteria	1321	Open in IMG/M
3300010430\|Ga0118733_101900692	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1184	Open in IMG/M
3300010430\|Ga0118733_102186123	Not Available	1098	Open in IMG/M
3300010430\|Ga0118733_102216016	Not Available	1090	Open in IMG/M
3300010430\|Ga0118733_103291769	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	880	Open in IMG/M
3300010430\|Ga0118733_103714118	All Organisms → cellular organisms → Bacteria	825	Open in IMG/M
3300010430\|Ga0118733_104046392	Not Available	787	Open in IMG/M
3300010430\|Ga0118733_105837327	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	646	Open in IMG/M
3300010430\|Ga0118733_106849785	Not Available	593	Open in IMG/M
3300010430\|Ga0118733_108888366	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	518	Open in IMG/M
3300010430\|Ga0118733_109470941	All Organisms → cellular organisms → Bacteria	501	Open in IMG/M
3300011262\|Ga0151668_1007443	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium	2665	Open in IMG/M
3300011262\|Ga0151668_1007495	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	963	Open in IMG/M
3300011262\|Ga0151668_1239489	Not Available	691	Open in IMG/M
3300013101\|Ga0164313_10671501	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	855	Open in IMG/M
3300013101\|Ga0164313_11246448	All Organisms → cellular organisms → Bacteria	601	Open in IMG/M
3300019711\|Ga0193993_1053636	Not Available	530	Open in IMG/M
3300019714\|Ga0193975_1042584	Not Available	565	Open in IMG/M
3300019714\|Ga0193975_1054533	Not Available	522	Open in IMG/M
3300019722\|Ga0193971_1065006	Not Available	507	Open in IMG/M
3300019730\|Ga0194001_1067088	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	513	Open in IMG/M
3300021859\|Ga0210334_10176640	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium ADurb.Bin002	1560	Open in IMG/M
3300022202\|Ga0224498_10022874	All Organisms → cellular organisms → Bacteria	1709	Open in IMG/M
3300022202\|Ga0224498_10119772	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	765	Open in IMG/M
3300022202\|Ga0224498_10147175	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacterium → environmental samples → uncultured Desulfobacterium sp.	690	Open in IMG/M
3300022206\|Ga0224499_10157348	All Organisms → cellular organisms → Bacteria	774	Open in IMG/M
3300022206\|Ga0224499_10163046	Not Available	759	Open in IMG/M
3300022206\|Ga0224499_10172450	Not Available	737	Open in IMG/M
3300022206\|Ga0224499_10289267	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfobacterium → environmental samples → uncultured Desulfobacterium sp.	554	Open in IMG/M
3300022206\|Ga0224499_10329547	Not Available	515	Open in IMG/M
3300022217\|Ga0224514_10047515	All Organisms → cellular organisms → Bacteria	1432	Open in IMG/M
3300022217\|Ga0224514_10068640	All Organisms → cellular organisms → Bacteria	1199	Open in IMG/M
3300022217\|Ga0224514_10145879	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfococcus → Desulfococcus multivorans	830	Open in IMG/M
3300022217\|Ga0224514_10183353	All Organisms → cellular organisms → Bacteria	743	Open in IMG/M
3300022217\|Ga0224514_10397425	All Organisms → cellular organisms → Bacteria	512	Open in IMG/M
3300022218\|Ga0224502_10394805	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius algarvensis associated proteobacterium Delta 3	537	Open in IMG/M
3300022308\|Ga0224504_10058188	All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Spirochaetaceae → Alkalispirochaeta → Alkalispirochaeta odontotermitis	1542	Open in IMG/M
3300022308\|Ga0224504_10270981	All Organisms → cellular organisms → Bacteria	702	Open in IMG/M
3300022308\|Ga0224504_10312230	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	652	Open in IMG/M
3300022391\|Ga0210374_1003781	All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia	1973	Open in IMG/M
(restricted) 3300024528\|Ga0255045_10249831	Not Available	704	Open in IMG/M
3300025557\|Ga0210141_1061915	All Organisms → cellular organisms → Bacteria	711	Open in IMG/M
3300025883\|Ga0209456_10005717	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	5561	Open in IMG/M
3300025883\|Ga0209456_10253734	All Organisms → cellular organisms → Bacteria	737	Open in IMG/M
3300025895\|Ga0209567_10179615	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	995	Open in IMG/M
3300025895\|Ga0209567_10205496	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	929	Open in IMG/M
3300025991\|Ga0210128_1016180	All Organisms → cellular organisms → Bacteria	1107	Open in IMG/M
3300027820\|Ga0209578_10086121	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	1563	Open in IMG/M
3300027828\|Ga0209692_10284343	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	733	Open in IMG/M
(restricted) 3300027837\|Ga0255041_10192852	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	715	Open in IMG/M
3300027845\|Ga0209271_10258153	Not Available	701	Open in IMG/M
3300027917\|Ga0209536_100636581	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	1326	Open in IMG/M
3300027917\|Ga0209536_101913152	Not Available	713	Open in IMG/M
3300027978\|Ga0209165_10010117	All Organisms → cellular organisms → Bacteria	3263	Open in IMG/M
3300027978\|Ga0209165_10032239	Not Available	1863	Open in IMG/M
3300027980\|Ga0209475_10160022	Not Available	1038	Open in IMG/M
3300028598\|Ga0265306_10355926	Not Available	793	Open in IMG/M
3300028599\|Ga0265309_11316312	Not Available	505	Open in IMG/M
3300031727\|Ga0316576_11353635	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	500	Open in IMG/M
3300032136\|Ga0316201_10383389	Not Available	1212	Open in IMG/M
3300032136\|Ga0316201_11679651	Not Available	524	Open in IMG/M
3300032231\|Ga0316187_10907270	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Olavius sp. associated proteobacterium Delta 1	648	Open in IMG/M
3300032251\|Ga0316198_10144706	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1395	Open in IMG/M
3300032258\|Ga0316191_10217072	Not Available	1395	Open in IMG/M
3300032258\|Ga0316191_10360970	Not Available	1057	Open in IMG/M
3300032258\|Ga0316191_10479135	Not Available	905	Open in IMG/M
3300032258\|Ga0316191_11425005	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	500	Open in IMG/M
3300032259\|Ga0316190_10367674	Not Available	979	Open in IMG/M
3300032259\|Ga0316190_10513511	Not Available	806	Open in IMG/M
3300032259\|Ga0316190_11155311	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	504	Open in IMG/M
3300032260\|Ga0316192_10113676	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales	1896	Open in IMG/M
3300032260\|Ga0316192_10216961	All Organisms → cellular organisms → Bacteria → Proteobacteria	1326	Open in IMG/M
3300032260\|Ga0316192_10568178	All Organisms → cellular organisms → Bacteria → Proteobacteria	769	Open in IMG/M
3300032262\|Ga0316194_10040076	All Organisms → cellular organisms → Bacteria	3083	Open in IMG/M
3300032262\|Ga0316194_10148238	Not Available	1509	Open in IMG/M
3300032262\|Ga0316194_10401573	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	866	Open in IMG/M
3300032262\|Ga0316194_10507663	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	760	Open in IMG/M
3300032262\|Ga0316194_10929763	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	547	Open in IMG/M
3300032272\|Ga0316189_10096494	All Organisms → cellular organisms → Bacteria	2418	Open in IMG/M
3300032272\|Ga0316189_10489888	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	946	Open in IMG/M
3300032272\|Ga0316189_10490750	Not Available	945	Open in IMG/M
3300032272\|Ga0316189_10613762	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfovibrionales → Desulfovibrionaceae → Halodesulfovibrio → Halodesulfovibrio aestuarii	832	Open in IMG/M
3300032272\|Ga0316189_10681151	All Organisms → cellular organisms → Bacteria	785	Open in IMG/M
3300032272\|Ga0316189_10819711	Not Available	707	Open in IMG/M
3300032276\|Ga0316188_10292294	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae	839	Open in IMG/M
3300033429\|Ga0316193_10093521	Not Available	2349	Open in IMG/M
3300033429\|Ga0316193_10515542	All Organisms → cellular organisms → Bacteria	952	Open in IMG/M
3300033429\|Ga0316193_10598786	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium	878	Open in IMG/M
3300033429\|Ga0316193_10688566	Not Available	814	Open in IMG/M
3300033429\|Ga0316193_11392289	All Organisms → cellular organisms → Bacteria	556	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	97.93%
Host-Associated	Host-Associated	1.38%
Engineered	Engineered	0.69%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	94.48%
Terrestrial	Environmental → Terrestrial	3.45%
Algae	Host-Associated → Algae	0.69%
Plants	Host-Associated → Plants	0.69%
Lab Enrichment	Engineered → Lab Enrichment	0.69%

Habitat	Taxonomy	Distribution
Marine	Environmental → Aquatic → Marine	89.66%
Freshwater	Environmental → Aquatic → Freshwater	3.45%
Soil	Environmental → Terrestrial → Soil	3.45%
Non-Marine Saline And Alkaline	Environmental → Aquatic → Non-Marine Saline And Alkaline	0.69%
Sediment	Environmental → Aquatic → Sediment	0.69%
Green Algae	Host-Associated → Algae → Green Algae	0.69%
Rhizosphere	Host-Associated → Plants → Rhizosphere	0.69%
Defined Media	Engineered → Lab Enrichment → Defined Media	0.69%

Habitat	Taxonomy	Distribution
Coastal	Environmental → Aquatic → Marine → Coastal	63.45%
Sediment	Environmental → Aquatic → Marine → Sediment	12.41%
Sediment	Environmental → Aquatic → Freshwater → Sediment	3.45%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	3.45%
Neritic Zone	Environmental → Aquatic → Marine → Neritic Zone	2.76%
Oceanic	Environmental → Aquatic → Marine → Oceanic	2.07%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	2.07%
Wetlands	Environmental → Aquatic → Marine → Wetlands	2.07%
Strait	Environmental → Aquatic → Marine → Strait	2.07%
Hydrothermal Vents	Environmental → Aquatic → Marine → Hydrothermal Vents	1.38%
Subtidal Zone	Environmental → Aquatic → Marine → Subtidal Zone	1.38%
Saline	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline	0.69%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.69%
Ectosymbionts	Host-Associated → Algae → Green Algae → Ectosymbionts	0.69%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	0.69%
Anaerobic Media	Engineered → Lab Enrichment → Defined Media → Anaerobic Media	0.69%

Habitat	Taxonomy	Distribution
Sediment	Environmental → Aquatic → Marine → Coastal → Sediment	61.38%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	12.41%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	3.45%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	3.45%
Unclassified	Environmental → Aquatic → Marine → Neritic Zone → Unclassified	2.76%
Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment	2.07%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	2.07%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	2.07%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	2.07%
Unclassified	Environmental → Aquatic → Marine → Strait → Unclassified	2.07%
Sediment	Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment	1.38%
Sediment	Environmental → Aquatic → Marine → Subtidal Zone → Sediment	1.38%
Unclassified	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified	0.69%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.69%
Unclassified	Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified	0.69%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	0.69%
Unclassified	Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified	0.69%

Habitat	Taxonomy	Distribution
Marine Sediment	Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment	20.00%
Marine	Environmental → Aquatic → Marine → Coastal → Sediment → Marine	19.31%
Worm Burrow	Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow	14.48%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	12.41%
Sediment	Environmental → Aquatic → Marine → Coastal → Sediment → Sediment	7.59%
Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment	3.45%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	3.45%
Pelagic Marine	Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine	2.76%
Marine	Environmental → Aquatic → Marine → Coastal → Unclassified → Marine	2.07%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	2.07%
Seawater	Environmental → Aquatic → Marine → Strait → Unclassified → Seawater	2.07%
Marine Sediment	Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment	1.38%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	1.38%
Marine Sediment	Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment	1.38%
Sediment	Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment	1.38%
Deep Subsurface	Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface	0.69%
Marine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine	0.69%
Pond Water	Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water	0.69%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.69%
Macroalgal Surface	Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface	0.69%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.69%
Marine Sediment	Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Marine Sediment	0.69%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000242	Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3m	Environmental	Open in IMG/M
3300001270	Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY91	Host-Associated	Open in IMG/M
3300004023	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordA_D2	Environmental	Open in IMG/M
3300005588	Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1	Environmental	Open in IMG/M
3300005589	Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2	Environmental	Open in IMG/M
3300005590	Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2	Environmental	Open in IMG/M
3300005600	Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1	Environmental	Open in IMG/M
3300005612	Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2	Environmental	Open in IMG/M
3300005826	Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.186_BBA	Environmental	Open in IMG/M
3300006467	Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935	Environmental	Open in IMG/M
3300007102	Combined Assembly of Marine Sediment Inoculum and Enrichments	Engineered	Open in IMG/M
3300009027	Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG	Environmental	Open in IMG/M
3300009035	Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MG	Environmental	Open in IMG/M
3300009145	Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D1_MG	Environmental	Open in IMG/M
3300009788	Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG	Environmental	Open in IMG/M
3300010392	Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385	Environmental	Open in IMG/M
3300010430	Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples	Environmental	Open in IMG/M
3300011262	Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, total	Environmental	Open in IMG/M
3300013101	Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cm	Environmental	Open in IMG/M
3300019711	Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BLC_4-5_MG	Environmental	Open in IMG/M
3300019714	Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FRT_2-3_MG	Environmental	Open in IMG/M
3300019722	Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRT_7-8_MG	Environmental	Open in IMG/M
3300019730	Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? FLT_7-8_MG	Environmental	Open in IMG/M
3300021859	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.306 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022202	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21	Environmental	Open in IMG/M
3300022206	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_24	Environmental	Open in IMG/M
3300022217	Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_24	Environmental	Open in IMG/M
3300022218	Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_13	Environmental	Open in IMG/M
3300022306	Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_24	Environmental	Open in IMG/M
3300022308	Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24	Environmental	Open in IMG/M
3300022391	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.765 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300024519 (restricted)	Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27	Environmental	Open in IMG/M
3300024528 (restricted)	Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23	Environmental	Open in IMG/M
3300025557	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_CordB_D2 (SPAdes)	Environmental	Open in IMG/M
3300025883	Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_11 (SPAdes)	Environmental	Open in IMG/M
3300025895	Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - COGITO 998_met_12 (SPAdes)	Environmental	Open in IMG/M
3300025991	Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordB_D2 (SPAdes)	Environmental	Open in IMG/M
3300027820	Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes)	Environmental	Open in IMG/M
3300027828	Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes)	Environmental	Open in IMG/M
3300027837 (restricted)	Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3	Environmental	Open in IMG/M
3300027845	Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes)	Environmental	Open in IMG/M
3300027917	Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)	Environmental	Open in IMG/M
3300027978	Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes)	Environmental	Open in IMG/M
3300027980	Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 (SPAdes)	Environmental	Open in IMG/M
3300028598	Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly)	Environmental	Open in IMG/M
3300028599	Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly)	Environmental	Open in IMG/M
3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Host-Associated	Open in IMG/M
3300032136	Coastal sediment microbial communities from Delaware Bay, Delaware, United States - CS-6 worm burrow	Environmental	Open in IMG/M
3300032231	Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1	Environmental	Open in IMG/M
3300032251	Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxic	Environmental	Open in IMG/M
3300032258	Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cm	Environmental	Open in IMG/M
3300032259	Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2	Environmental	Open in IMG/M
3300032260	Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrow	Environmental	Open in IMG/M
3300032262	Coastal sediment microbial communities from Maine, United States - Cross River sediment 1	Environmental	Open in IMG/M
3300032272	Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow	Environmental	Open in IMG/M
3300032276	Coastal sediment microbial communities from Maine, United States - Phippsburg worm burrow 1	Environmental	Open in IMG/M
3300033429	Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
TDF_OR_ARG05_123mDRAFT_10921621	3300000242	Marine	LNSNIKNSNKIKNQLFGILNFGHCDLFGICDLLFEIFYC*
BBAY91_101931472	3300001270	Macroalgal Surface	NYNIQISNEIKRQLFGFLNFCHCDLFGICDLLFEFFNC*
Ga0055441_101578531	3300004023	Natural And Restored Wetlands	IPNYNIQISNKIKNQLFGFLNFNHCDLFGIWVLLFEISYLLTPET*
Ga0070728_101248002	3300005588	Marine Sediment	STKLQINYNIQISNKIKNQLFGILNFGDCDLFGICILLFEIF*
Ga0070728_103537181	3300005588	Marine Sediment	NIQISNKIKNQLFGILNFGHCDLFGICVLLFVNC*
Ga0070728_106213822	3300005588	Marine Sediment	IQISNKIKNQLFGILNFGHCDLFGICDLLFEIFNC*
Ga0070728_106603072	3300005588	Marine Sediment	LNIKISNKIKNQLFGILNFCHCDLFVICVLLFEIFYH*
Ga0070729_103699953	3300005589	Marine Sediment	KFQISNKIKSQLFGILNFGHCYLFVICVLLFEIFITET*
Ga0070729_105260202	3300005589	Marine Sediment	IQISNKIKNQLFGILNFGHCDLFGICVLSFEICSLLKPERRNL*
Ga0070727_104362321	3300005590	Marine Sediment	NYNIQISNKIKNQLFGILNFGHCDLFGIWYLLFEIF*
Ga0070727_108048202	3300005590	Marine Sediment	SNKIKSQLFGILNFGHCYLFVICVLLFEIFITET*
Ga0070726_101503891	3300005600	Marine Sediment	NIQISNKIKSQLFGILNFSHCDLFGIYDLLFVIF*
Ga0070726_102172062	3300005600	Marine Sediment	NSNIQISNKIKSQLFGILNFGHCDLFSICDLVFVIF*
Ga0070726_106400871	3300005600	Marine Sediment	NKFQISNKIKSQLFGILNFGHCYLFVICVLLFEIFITET*
Ga0070723_105890102	3300005612	Marine Sediment	YNIQISNKIKNQLFGILNFGHCDLFGICVLLFEIF*
Ga0074477_16818792	3300005826	Sediment (Intertidal)	KHQISNNIKILLFGILNFGHCDLFGSCDLLFEIY*
Ga0099972_100405663	3300006467	Marine	QKIPNYNIQISNKIKRQLFGILNFDHCDLFGICDLLFEIF*
Ga0099972_102625222	3300006467	Marine	IQISNKIKSQLFGILNFGHCDLFGICDLLFEIYYY*
Ga0099972_108172101	3300006467	Marine	IPNYNIQISNKIKRQLFGLRRAQPCRILNFGYCDLFGICVLLFEIFYY*
Ga0099972_108762262	3300006467	Marine	NYNIQISNKIKNQLFGILNFGHCDLFGVCVLLFDIF*
Ga0099972_117394222	3300006467	Marine	SNIQISNKIKNQLFGILNFGHCDLFVICVLLFEIF*
Ga0099972_125172231	3300006467	Marine	DNFQISNKIKSQLFGILNFGHCDLFGTCVLLFENF*
Ga0099972_125198951	3300006467	Marine	YNIEISNKIKSQLFGILNFGHYDLFGIWYLLFEIFNC*
Ga0099972_132996371	3300006467	Marine	IPNCNIQISNKIKRQLFGILNFVHCDLFDICVLLFEIC*
Ga0099972_133672451	3300006467	Marine	IPNLNIKISNKIKSQLFGILNFGHCDLFGICVLLFEFFYY*
Ga0099972_135444051	3300006467	Marine	IPNYNIQISNKIKRQLFGILNLGHCDLFGICDLLFEIF*
Ga0102541_14372331	3300007102	Marine Sediment	NIQISNKIKSQLFGILNFGHYDLFGICVLLFEIVNC*
Ga0102957_12654411	3300009027	Pond Water	IPNNNIQISNKVKRKLFGISNFGHCGLFVICDLKFFKC*
Ga0102958_12611061	3300009035	Soil	IQILNKIKNHLFGLLKFGHCDLFGHCVLLLEIFYLLNPDT*
Ga0102958_13286001	3300009035	Soil	NYNIQISNKIKRQLFGILNLGHCDLFGIYDLLFEIF*
Ga0102961_11028592	3300009145	Soil	NSQISNKIKSQVFGILNFGHCDLFGICYLVLEIF*
Ga0102961_11827331	3300009145	Soil	KLQVPNFNIQISNKIKNQLFRILNFGYCDLCFDI*
Ga0102961_12634112	3300009145	Soil	PNYNIQISNKIKRQLFGILNLGHCDLFGICYLLFENF*
Ga0114923_108248222	3300009788	Deep Subsurface	NIQISNKIKSQVFGILNFSHCDLFDICDLLFEIFYLLKPEH*
Ga0118731_1019666011	3300010392	Marine	NIQISNKIKSQLFGILNFGHCDLFGICDLLFEIFYY*
Ga0118731_1042050682	3300010392	Marine	FQISNKIKSQLFGILNFGHCYLFVICVLLFEIFITET*
Ga0118731_1043714841	3300010392	Marine	NIQISNKIKSQLFGILNFGHCDLFGICVLLFEILITDT*
Ga0118731_1048437811	3300010392	Marine	NYNIQISNNIKSQVFGILNFSHCDLFGICDLLFEIF*
Ga0118731_1048461652	3300010392	Marine	NYNIQISNKIESQLFGILNFGHCDLFGICDLLFEIFIADT*
Ga0118731_1052851132	3300010392	Marine	IPNLNIKISTKFKRQLFGILNFGHCDLFGICDLLFEFFF*
Ga0118731_1061477812	3300010392	Marine	NIKISNKIKSQLFGILNFGHCDLIGICVLLFEIFYY*
Ga0118731_1061491021	3300010392	Marine	NIKISNKIKSQLFGILNFGHCVLFGICVLLFEIFYY*
Ga0118731_1074509971	3300010392	Marine	ISNKIKSQLFGILNFGHCDLFGICVLLFEISITDI*
Ga0118731_1076521731	3300010392	Marine	NYNIQISNMIKGQLFGILNLGHCDLFGICDLLFEIFNC*
Ga0118731_1083474261	3300010392	Marine	QITNKFQISNKIKSQLFGILNFGHCYLFVICDLLFEIFYY*
Ga0118731_1098099251	3300010392	Marine	QISNKTNRQLFGILNFGHCDLFGICVLLFETLIAET*
Ga0118731_1099215751	3300010392	Marine	IQISNKIKRQLFGILNFGHCYLFVICVLLFEIFITET*
Ga0118731_1120512942	3300010392	Marine	YNVQISNKIKRQSFEILNLGHCGLFGICYLLFEIFKY*
Ga0118731_1126766721	3300010392	Marine	IQISNKIKSQLFGILNFGHCDLFGICVLLFEIFLLLKPER*
Ga0118731_1133528341	3300010392	Marine	NTNIQISNKIKSQSFGILNFGHCDLFGFCDLLFEIFYY*
Ga0118731_1144298221	3300010392	Marine	NIQISNKIKRQLFEILNLGHCDLIGICDLLFEIFNC*
Ga0118731_1149503812	3300010392	Marine	VFDKFQISNKIKSQLFGILNFGHCDLFGICILLFEIFYY*
Ga0118733_1015499251	3300010430	Marine Sediment	ISNKIKSQLFGILNFGHCYLFVICVLLFEIFITET*
Ga0118733_1019006921	3300010430	Marine Sediment	SNKIKRQLFGILNFGHCDLFGICVLLFEIFLLLKPEH*
Ga0118733_1021861231	3300010430	Marine Sediment	NIQISNKIKSQLFGVLNFGHCDLFGICDLIFEIFYY*
Ga0118733_1022160161	3300010430	Marine Sediment	NIQISNKIKSQLFGIFNFGHCDLFGICDLLFEIFLIAET*
Ga0118733_1032917692	3300010430	Marine Sediment	NIQISNKIKNQLFGILKFGHCYLFVICVLLFEIF*
Ga0118733_1037141181	3300010430	Marine Sediment	QISNKIKRQLFGILKFGHCDLFGICDLLFEIFLLKPEH*
Ga0118733_1040463921	3300010430	Marine Sediment	NIQISNKIKSQLFGILNFGHCDLFGICVLLFEIF*
Ga0118733_1058373271	3300010430	Marine Sediment	YNIQISNKIKRQLFGILNLGHCDLFGICDLLFEIY*
Ga0118733_1068497851	3300010430	Marine Sediment	QISNKIKRQLFGILNFSHCDLFGICDLLFEIFYY*
Ga0118733_1088883662	3300010430	Marine Sediment	NIQISNKIKNQLFGILNFGHCDLFGICVLLFEIF*
Ga0118733_1094709411	3300010430	Marine Sediment	IPNSNIQISNKIKNQLFGILNFSHCDLFGICVLLFEIFVHYPLSR*
Ga0151668_10074431	3300011262	Marine	NIQISIKINHQLFGILNFGHCNLFGICDLLFEIY*
Ga0151668_10074952	3300011262	Marine	LQAPNYKLIPNFNIQISSKIKRQLFGILNFGFCDLLFEIFLIA*
Ga0151668_12394892	3300011262	Marine	TNLNIQISNKFKNQLFGILSFSHCDLFGHCDLLFGIF*
Ga0164313_106715012	3300013101	Marine Sediment	HQNTNNFQISKKIKTQLFGILNFGHCDLFGICELLFDIF*
Ga0164313_112464481	3300013101	Marine Sediment	INEECPNYNIQISNKIKRQLFGILNFGHCDLFDICDLLFEIF*
Ga0193993_10536361	3300019711	Sediment	KLRSYTNPSNKIERQLFGILNFGHCDLFGFCDLWFDIFSY
Ga0193975_10425842	3300019714	Sediment	KSQIRSKSQLFGILNFGHCDLFGICDLLFEILIVKT
Ga0193975_10545331	3300019714	Sediment	NLDIKNPKSQAPNYKKIPNLNIKISNKIKSQLFGICVLLFEIFYY
Ga0193971_10650061	3300019722	Sediment	INYKNSETLNYNIQISNKIKSQLFEILNFGHCDLFGICVLLLAIF
Ga0194001_10670882	3300019730	Sediment	LNIQISNNVKSQLFGIFNFGHCDLFGICFLLFEIFCY
Ga0210334_101766402	3300021859	Estuarine	QNLNIQITNKIKSQLFGILNLVHCDLFGICVLLFEIFYY
Ga0224498_100228742	3300022202	Sediment	INYNIQISNKIKSELFGILNFGHCYLFVICVLLFEIFITET
Ga0224498_101197722	3300022202	Sediment	NYNIQISNKIKRQLFGILDFGHYNLFGICVLLFGIFFIAET
Ga0224498_101471752	3300022202	Sediment	QIYNIQISNKIKSQLFGILNFGHCDLFGFWFLLFEIFLLLKS
Ga0224499_101573481	3300022206	Sediment	ITNYKHQITNKIKNQLFGILNFGHCDLFGICDLLFEIF
Ga0224499_101630461	3300022206	Sediment	YNIQILNKIKNQLFVILNFGHCDLFGICVLLFEIFIDT
Ga0224499_101724501	3300022206	Sediment	STKLQINSNIQISNKIKRQLFRILNFGHCDLFGICGLLFEIFNC
Ga0224499_102892671	3300022206	Sediment	IYNIQISNKIKSQLFGILNFGHCDLFGFWFLLFEIFLLLKS
Ga0224499_103295471	3300022206	Sediment	MSNKTKSQLFGILNFGHCDLFGIWYLLFVIFLIAETP
Ga0224514_100475151	3300022217	Sediment	LIALNYNIQISNKIKSQLFEILNFGHCDLFGICVLLFAIF
Ga0224514_100686403	3300022217	Sediment	NYNIQISNKLKRQLFGILNFGHCDFFGVCVLLFEIF
Ga0224514_101458791	3300022217	Sediment	NIKISNKIKRQLFGILNFGHCDLFVICDLLFEIFYY
Ga0224514_101833531	3300022217	Sediment	HNIQISNKIKRQLFGILNLGHCDLFGICDLFFEIF
Ga0224514_103974252	3300022217	Sediment	TNYNIQISNKIERQLFGILNFGDCDLFVICVLLFEIF
Ga0224502_103948052	3300022218	Sediment	DQINSNIQISNKIKRQLFGILNLGHCDLFGICDLFFEIFYCT
Ga0224509_100588393	3300022306	Sediment	GNNKLQAPNYNIQISNKIKRQLFGILNFGHCDLFGICFLKFFNC
Ga0224504_100581881	3300022308	Sediment	NYNIQISNKIKRQLFGILNFGYCDLFGICYLLFEIC
Ga0224504_102709811	3300022308	Sediment	LQAANYKKIPNCNVQISNKIKNQLFGILNFGHCDLFGICVLLIEIF
Ga0224504_103122301	3300022308	Sediment	NLNIKISNKIISQLFAILNFGHCDLFGICFLLFEIF
Ga0210374_10037814	3300022391	Estuarine	EITNRKHQISNNIKILLFGILNFGHCDLSGICDLLFEIY
(restricted) Ga0255046_103244041	3300024519	Seawater	YKHQITNKFQISNKIKRQLFGILKFGICDLLFEIFLLKPEH
(restricted) Ga0255045_102498311	3300024528	Seawater	MGSCEKSTNKNDKDRFGILNFGHCDLFVLCDLLFGI
Ga0210141_10619151	3300025557	Natural And Restored Wetlands	QISNKIKNQLFRILNFGYCDLFVLCVLIFEFLFAET
Ga0209456_100057175	3300025883	Pelagic Marine	QLFGILNFGHCDLFGICVLLFEILITETRIRRRNT
Ga0209456_102537341	3300025883	Pelagic Marine	NNKLQINYSIQISSKINSQLFGILNFGHCDLPFDLAQGG
Ga0209567_101796151	3300025895	Pelagic Marine	PFTNPSNKFKSQLFGILNFGHCDLFGICDLLFEIF
Ga0209567_102054962	3300025895	Pelagic Marine	LQAPNYNIQISNKIKRQLFGILNLGHCDLFGICDLLFEIFNC
Ga0210128_10161802	3300025991	Natural And Restored Wetlands	ETLNYNIQISNKIKSQLFEILNFGHCDLFGICVLLFAIF
Ga0209578_100861213	3300027820	Marine Sediment	IQISNKIKRQLFGILNFGHCDLFGFCDLLFEIFYC
Ga0209692_102843431	3300027828	Marine Sediment	NSNIQISNKIKNQSFGVLNFGHCDLFVICVLLFEISLIDET
(restricted) Ga0255041_101928521	3300027837	Seawater	SNKIKSQIFGILNFGHCDLFGICFLLFGIFLTEIRT
Ga0209271_102581531	3300027845	Marine Sediment	PNYNIQISNKIKNQLFGIWNFGHCDLFGICVLLFEIF
Ga0209536_1006365813	3300027917	Marine Sediment	PNDNIQISNKIKNQSFGISNFGLCDLFFICDLEFFTET
Ga0209536_1019131522	3300027917	Marine Sediment	DSIQISNKIKSQLFGILNFGHCDLLGICDLLFEIFYY
Ga0209165_100101174	3300027978	Marine Sediment	PNYNIQISNKIKIQLFGILNFGHCDLFGICILLFENFYC
Ga0209165_100322391	3300027978	Marine Sediment	IQISNKIKRQLFGILNFSHCDLFGIWYLFFEVFYY
Ga0209475_101600221	3300027980	Marine Sediment	INSNSQISNKINSHMFGIFFNFGHCYLFGIYVLLFEILNY
Ga0265306_103559261	3300028598	Sediment	NIQISNKTNRHLFGILNFGHCDLFGICVLLFETLIAET
Ga0265309_113163121	3300028599	Sediment	NYNIQISNKIKNQLFGILNFGHCDLFGICGLLFEIF
Ga0316576_113536351	3300031727	Rhizosphere	NIQIRQWRVKRKRFGILNFGNCNLFGICDLLFEIFCY
Ga0316201_103833892	3300032136	Worm Burrow	IPNLNIKISNKVKSQLFGILNFGHCDLFGIYVLLFEIF
Ga0316201_116796512	3300032136	Worm Burrow	APNENIQILNKIKRQLFGFLNFGHCDLLFEISYLLKPEH
Ga0316187_109072702	3300032231	Worm Burrow	NIQISIKVKSQLFGILNFGHCDLFGICVLLFEILIAEI
Ga0316198_101447061	3300032251	Sediment	ISNKIKSQLFGILNFGHCDLFGICDLLFEISITDI
Ga0316191_102170721	3300032258	Worm Burrow	PNPNIQISNKIKRQLFGILNFGHCDLFGICVLLFEILITDT
Ga0316191_103609701	3300032258	Worm Burrow	IQISNKIKNQLFGILNFGHCDLFGICVLLFEIFVYYPLSR
Ga0316191_104791351	3300032258	Worm Burrow	SLYTNKIKHQLFGILNFGHCKLFGVYDLLFEIFYY
Ga0316191_114250051	3300032258	Worm Burrow	QYFKYPNKIKRRLFRILNFGHCDLFGICNLLFEIF
Ga0316190_103676741	3300032259	Worm Burrow	YNIQISNKIKNQLFGILNFGNCDLFDICDLLFGIFNY
Ga0316190_105135111	3300032259	Worm Burrow	YKHQITNKIKRQLFGILNFGHCDLFGICDLLFEIF
Ga0316190_111553111	3300032259	Worm Burrow	RTIKSQISNKIKNQLLGILNFGHCDLFGICVLLFEIY
Ga0316192_101136761	3300032260	Worm Burrow	ENYKKIPNCNVQISNKIKNQLFGILNFGHCDLFGICVLLIEIF
Ga0316192_102169611	3300032260	Worm Burrow	TTIQISNKIKRRLFGILNFGHCDLFGFCDLLFEIFYY
Ga0316192_102970962	3300032260	Worm Burrow	MQNPAELLLNPKLQEPNYNIQISNKIKNQLFAILNFGHCDLFGICDLLFEIFNC
Ga0316192_105681783	3300032260	Worm Burrow	NYNIQISNKIKSQLFGILNFGHYDLLLEFFLLKPEH
Ga0316194_100400761	3300032262	Sediment	NHNIQISNKIKSQLFGILNFGHCDLFGICDLLFFITET
Ga0316194_101482382	3300032262	Sediment	MFNIQISNKVKRQLFGILNFGHCDLFIICVLLFEIL
Ga0316194_104015731	3300032262	Sediment	QAPNYNIQISNKTKSQLFGILNFDHCDLFGICVLLFEIF
Ga0316194_105076631	3300032262	Sediment	YNIQNSNNIKNQLFGILNFGHCDLFGICVLLFEIF
Ga0316194_109297631	3300032262	Sediment	PNYNIQISNKIKRRLFGILNLGHCDLFDICDLLFEIF
Ga0316189_100964944	3300032272	Worm Burrow	QISNKLKRQLFGILNFGHCDLFGICVLLFEFFITWLTIIT
Ga0316189_104898881	3300032272	Worm Burrow	ITSTKLQINSNIQISNKIKSQLFGILNLGHCDLLFEIF
Ga0316189_104907501	3300032272	Worm Burrow	YNIQTRQRRIKSQLFGILNFGHFDLFDICDLLFEIFYY
Ga0316189_106137623	3300032272	Worm Burrow	QIKNKIKNQLFGILNFGNCDLFGICVLLFKNFFNC
Ga0316189_106811511	3300032272	Worm Burrow	IPNCNIQISNKIKRQLFGILNLGHCDLFGIYDLLFEIF
Ga0316189_108197112	3300032272	Worm Burrow	IANYNIQISNKIKRQLFGILNFGHCDLFGICFLVFEIF
Ga0316188_102922942	3300032276	Worm Burrow	NDNIQISNNFKRQLFGILNFGHCDLFGICVLLFEIFDY
Ga0316193_100935213	3300033429	Sediment	IPNYNIQISNKIKRQLFGILSFGYCDLFVICVLLFEIF
Ga0316193_105155422	3300033429	Sediment	IQISNKVKIQLFRILNFSHCDLFGICDLLFEIFIADT
Ga0316193_105987861	3300033429	Sediment	PNYNIQISNKDKSQLFGILNFGHCDLFVICVLLFEIF
Ga0316193_106885661	3300033429	Sediment	YNIQISNKIKRQLFVILNFGFCDFFGICYLKFFNY
Ga0316193_113922891	3300033429	Sediment	NNNLQAPNYNIQISNRIKNPLFGILNFGHCDLFGICDLLFEIF

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters