NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F066421

Metatranscriptome Family F066421

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F066421
Family Type Metatranscriptome
Number of Sequences 126
Average Sequence Length 157 residues
Representative Sequence LSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGTMRPDGGVQASGNC
Number of Associated Samples 105
Number of Associated Scaffolds 126

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 4.84 %
% of genes near scaffold ends (potentially truncated) 89.68 %
% of genes from short scaffolds (< 2000 bps) 98.41 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (98.413 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(73.809 % of family members)
Environment Ontology (ENVO) Unclassified
(92.857 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(87.302 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 13.16%    β-sheet: 16.45%    Coil/Unstructured: 70.39%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.41 %
UnclassifiedrootN/A1.59 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300008832|Ga0103951_10616896All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii591Open in IMG/M
3300008834|Ga0103882_10059404All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii598Open in IMG/M
3300008928|Ga0103711_10006893All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum1376Open in IMG/M
3300008928|Ga0103711_10022636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum854Open in IMG/M
3300008928|Ga0103711_10023581All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum839Open in IMG/M
3300008928|Ga0103711_10067286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum529Open in IMG/M
3300008928|Ga0103711_10068162All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii526Open in IMG/M
3300009006|Ga0103710_10042313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum1021Open in IMG/M
3300009006|Ga0103710_10060323All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum884Open in IMG/M
3300009006|Ga0103710_10091965All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum744Open in IMG/M
3300009025|Ga0103707_10206325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum503Open in IMG/M
3300009028|Ga0103708_100014152All Organisms → cellular organisms → Eukaryota → Sar1395Open in IMG/M
3300009274|Ga0103878_1032944All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii583Open in IMG/M
3300009276|Ga0103879_10028849All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii598Open in IMG/M
3300009511|Ga0129277_1008666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum803Open in IMG/M
3300009532|Ga0129360_1005281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum818Open in IMG/M
3300009543|Ga0115099_10172451All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum612Open in IMG/M
3300009679|Ga0115105_11404901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum790Open in IMG/M
3300017113|Ga0186446_113626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum567Open in IMG/M
3300018580|Ga0193510_1012692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum570Open in IMG/M
3300018591|Ga0193398_1002652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum721Open in IMG/M
3300018605|Ga0193339_1018220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum677Open in IMG/M
3300018605|Ga0193339_1019814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum651Open in IMG/M
3300018616|Ga0193064_1014973All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum691Open in IMG/M
3300018637|Ga0192914_1007816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum784Open in IMG/M
3300018639|Ga0192864_1056789All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii565Open in IMG/M
3300018645|Ga0193071_1018153All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii523Open in IMG/M
3300018649|Ga0192969_1040920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum679Open in IMG/M
3300018649|Ga0192969_1045199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum629Open in IMG/M
3300018659|Ga0193067_1052922All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii596Open in IMG/M
3300018661|Ga0193122_1034806All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum741Open in IMG/M
3300018668|Ga0193013_1058322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum521Open in IMG/M
3300018674|Ga0193166_1022802All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii573Open in IMG/M
3300018675|Ga0193384_1017319All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum769Open in IMG/M
3300018676|Ga0193137_1060332All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii545Open in IMG/M
3300018676|Ga0193137_1069272All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum505Open in IMG/M
3300018681|Ga0193206_1024362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum668Open in IMG/M
3300018699|Ga0193195_1046998All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii521Open in IMG/M
3300018711|Ga0193069_1051915All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii503Open in IMG/M
3300018723|Ga0193038_1077012All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii508Open in IMG/M
3300018741|Ga0193534_1053870All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum607Open in IMG/M
3300018745|Ga0193000_1036170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum744Open in IMG/M
3300018746|Ga0193468_1049786All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum606Open in IMG/M
3300018747|Ga0193147_1050140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum707Open in IMG/M
3300018754|Ga0193346_1052306All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii550Open in IMG/M
3300018764|Ga0192924_1025931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum704Open in IMG/M
3300018764|Ga0192924_1026165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum701Open in IMG/M
3300018773|Ga0193396_1044439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum699Open in IMG/M
3300018778|Ga0193408_1044054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum694Open in IMG/M
3300018782|Ga0192832_1030353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum715Open in IMG/M
3300018795|Ga0192865_10056999All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum690Open in IMG/M
3300018795|Ga0192865_10066172All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii632Open in IMG/M
3300018795|Ga0192865_10070722All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii606Open in IMG/M
3300018798|Ga0193283_1007608All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum1662Open in IMG/M
3300018799|Ga0193397_10010649All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii588Open in IMG/M
3300018807|Ga0193441_1080317All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii565Open in IMG/M
3300018827|Ga0193366_1036745All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum689Open in IMG/M
3300018828|Ga0193490_1069917All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum574Open in IMG/M
3300018844|Ga0193312_1026598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum764Open in IMG/M
3300018844|Ga0193312_1029599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum737Open in IMG/M
3300018855|Ga0193475_1065610All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii584Open in IMG/M
3300018873|Ga0193553_1155873All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii513Open in IMG/M
3300018881|Ga0192908_10023256All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum646Open in IMG/M
3300018888|Ga0193304_1062705All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum714Open in IMG/M
3300018904|Ga0192874_10062839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum690Open in IMG/M
3300018927|Ga0193083_10041321All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum660Open in IMG/M
3300018943|Ga0193266_10156417All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii549Open in IMG/M
3300018945|Ga0193287_1085318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum691Open in IMG/M
3300018957|Ga0193528_10259646All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii598Open in IMG/M
3300018961|Ga0193531_10302420All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii551Open in IMG/M
3300018964|Ga0193087_10158461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum733Open in IMG/M
3300018967|Ga0193178_10041193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum669Open in IMG/M
3300018974|Ga0192873_10320057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum653Open in IMG/M
3300018975|Ga0193006_10152348All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum689Open in IMG/M
3300018976|Ga0193254_10129647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum580Open in IMG/M
3300018979|Ga0193540_10118827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum738Open in IMG/M
3300018985|Ga0193136_10125737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum752Open in IMG/M
3300018985|Ga0193136_10183463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum624Open in IMG/M
3300018985|Ga0193136_10271832All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii502Open in IMG/M
3300018988|Ga0193275_10149140All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum710Open in IMG/M
3300019001|Ga0193034_10121151All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii616Open in IMG/M
3300019001|Ga0193034_10131085All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii597Open in IMG/M
3300019007|Ga0193196_10412436All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii564Open in IMG/M
3300019007|Ga0193196_10447426All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii533Open in IMG/M
3300019012|Ga0193043_10302836All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii578Open in IMG/M
3300019012|Ga0193043_10338082All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii530Open in IMG/M
3300019021|Ga0192982_10299424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum577Open in IMG/M
3300019022|Ga0192951_10162285All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum796Open in IMG/M
3300019024|Ga0193535_10139325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum789Open in IMG/M
3300019027|Ga0192909_10113752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum717Open in IMG/M
3300019037|Ga0192886_10182138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum667Open in IMG/M
3300019039|Ga0193123_10229912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum728Open in IMG/M
3300019039|Ga0193123_10256787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum686Open in IMG/M
3300019040|Ga0192857_10279969All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii564Open in IMG/M
3300019048|Ga0192981_10286465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum619Open in IMG/M
3300019049|Ga0193082_10466516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum696Open in IMG/M
3300019053|Ga0193356_10189517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum723Open in IMG/M
3300019067|Ga0193459_103671All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii542Open in IMG/M
3300019068|Ga0193461_104539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum665Open in IMG/M
3300019070|Ga0193485_100188All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum1684Open in IMG/M
3300019111|Ga0193541_1089703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum528Open in IMG/M
3300019112|Ga0193106_1025199All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum661Open in IMG/M
3300019112|Ga0193106_1025568All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum658Open in IMG/M
3300019134|Ga0193515_1053041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum728Open in IMG/M
3300019144|Ga0193246_10255758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum536Open in IMG/M
3300019150|Ga0194244_10104820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum537Open in IMG/M
3300019151|Ga0192888_10199006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum609Open in IMG/M
3300021877|Ga0063123_1015053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum614Open in IMG/M
3300021881|Ga0063117_1017179All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum650Open in IMG/M
3300021886|Ga0063114_1046454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum538Open in IMG/M
3300030749|Ga0073969_10028744All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii532Open in IMG/M
3300030787|Ga0073965_11788998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum650Open in IMG/M
3300030871|Ga0151494_1095974All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum666Open in IMG/M
3300030921|Ga0073951_10003206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum581Open in IMG/M
3300030951|Ga0073937_10020268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum544Open in IMG/M
3300030952|Ga0073938_12164644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum668Open in IMG/M
3300030953|Ga0073941_10018350All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii532Open in IMG/M
3300030954|Ga0073942_11614630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum694Open in IMG/M
3300030958|Ga0073971_10035782All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum777Open in IMG/M
3300031052|Ga0073948_1871134All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum540Open in IMG/M
3300031063|Ga0073961_12224758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum784Open in IMG/M
3300031126|Ga0073962_11962228All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii591Open in IMG/M
3300031445|Ga0073952_11284081All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Bacillariophyta → Mediophyceae → Lithodesmiophycidae → Lithodesmiales → Lithodesmiaceae → Ditylum → Ditylum brightwellii507Open in IMG/M
3300031737|Ga0307387_10500687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum752Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine73.81%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine13.49%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water7.94%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water2.38%
Meromictic PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond1.59%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008834Eukaryotic communities of water from the North Atlantic ocean - ACM26EnvironmentalOpen in IMG/M
3300008928Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E3EnvironmentalOpen in IMG/M
3300009006Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_E2EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009274Eukaryotic communities of water from the North Atlantic ocean - ACM10EnvironmentalOpen in IMG/M
3300009276Eukaryotic communities of water from the North Atlantic ocean - ACM57EnvironmentalOpen in IMG/M
3300009511Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, surface; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300009532Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 1, Depth 3m; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017113Metatranscriptome of marine eukaryotic communities from Great South Bay, New York in GSe medium with ammonium, 22 C, 32 psu salinity and 177 ?mol photons light - Aureococcus anophagefferens CCMP 1850 (MMETSP0915)Host-AssociatedOpen in IMG/M
3300018580Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_139 - TARA_N000003039 (ERX1789370-ERR1719227)EnvironmentalOpen in IMG/M
3300018591Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002039 (ERX1782350-ERR1711882)EnvironmentalOpen in IMG/M
3300018605Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001754 (ERX1782444-ERR1712177)EnvironmentalOpen in IMG/M
3300018616Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003003 (ERX1782367-ERR1711877)EnvironmentalOpen in IMG/M
3300018637Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000837 (ERX1782121-ERR1712056)EnvironmentalOpen in IMG/M
3300018639Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000791 (ERX1782310-ERR1712181)EnvironmentalOpen in IMG/M
3300018645Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002739 (ERX1789677-ERR1719371)EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018659Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782249-ERR1712111)EnvironmentalOpen in IMG/M
3300018661Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782311-ERR1712063)EnvironmentalOpen in IMG/M
3300018668Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002464 (ERX1782441-ERR1712149)EnvironmentalOpen in IMG/M
3300018674Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_026 - TARA_E400007200 (ERX1782187-ERR1712006)EnvironmentalOpen in IMG/M
3300018675Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_123 - TARA_N000001994 (ERX1789575-ERR1719413)EnvironmentalOpen in IMG/M
3300018676Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782202-ERR1711913)EnvironmentalOpen in IMG/M
3300018681Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000072 (ERX1782177-ERR1712164)EnvironmentalOpen in IMG/M
3300018699Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000008 (ERX1782338-ERR1712211)EnvironmentalOpen in IMG/M
3300018711Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003139 (ERX1782287-ERR1712099)EnvironmentalOpen in IMG/M
3300018723Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000268 (ERX1782137-ERR1712170)EnvironmentalOpen in IMG/M
3300018741Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018746Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002179 (ERX1789625-ERR1719155)EnvironmentalOpen in IMG/M
3300018747Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000696 (ERX1782435-ERR1712076)EnvironmentalOpen in IMG/M
3300018754Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001810 (ERX1789618-ERR1719236)EnvironmentalOpen in IMG/M
3300018764Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000868 (ERX1782470-ERR1712186)EnvironmentalOpen in IMG/M
3300018773Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002037 (ERX1789391-ERR1719301)EnvironmentalOpen in IMG/M
3300018778Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002019 (ERX1789532-ERR1719207)EnvironmentalOpen in IMG/M
3300018782Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000570 (ERX1782313-ERR1712019)EnvironmentalOpen in IMG/M
3300018795Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000791 (ERX1782279-ERR1712192)EnvironmentalOpen in IMG/M
3300018798Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001604 (ERX1789622-ERR1719156)EnvironmentalOpen in IMG/M
3300018799Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_124 - TARA_N000002039 (ERX1782418-ERR1711999)EnvironmentalOpen in IMG/M
3300018807Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002356 (ERX1789611-ERR1719493)EnvironmentalOpen in IMG/M
3300018816Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001814 (ERX1789388-ERR1719355)EnvironmentalOpen in IMG/M
3300018827Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001938 (ERX1782415-ERR1712182)EnvironmentalOpen in IMG/M
3300018828Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_137 - TARA_N000002925 (ERX1789466-ERR1719252)EnvironmentalOpen in IMG/M
3300018844Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001656 (ERX1782100-ERR1711982)EnvironmentalOpen in IMG/M
3300018855Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782341-ERR1711903)EnvironmentalOpen in IMG/M
3300018873Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098EnvironmentalOpen in IMG/M
3300018881Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782151-ERR1712094)EnvironmentalOpen in IMG/M
3300018888Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001648 (ERX1789571-ERR1719332)EnvironmentalOpen in IMG/M
3300018904Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000742 (ERX1789433-ERR1719416)EnvironmentalOpen in IMG/M
3300018927Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782133-ERR1712125)EnvironmentalOpen in IMG/M
3300018943Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001290 (ERX1789547-ERR1719206)EnvironmentalOpen in IMG/M
3300018945Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001608 (ERX1789687-ERR1719388)EnvironmentalOpen in IMG/M
3300018957Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782215-ERR1712088)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018964Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000939 (ERX1782328-ERR1712130)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018985Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782416-ERR1711874)EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019007Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000011 (ERX1782393-ERR1712012)EnvironmentalOpen in IMG/M
3300019012Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001426 (ERX1809764-ERR1740129)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019049Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000531 (ERX1782179-ERR1712232)EnvironmentalOpen in IMG/M
3300019053Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001823 (ERX1782123-ERR1712241)EnvironmentalOpen in IMG/M
3300019067Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002412 (ERX1782229-ERR1712040)EnvironmentalOpen in IMG/M
3300019068Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002414 (ERX1782336-ERR1711930)EnvironmentalOpen in IMG/M
3300019070Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002963 (ERX1789706-ERR1719363)EnvironmentalOpen in IMG/M
3300019111Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782321-ERR1712210)EnvironmentalOpen in IMG/M
3300019112Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000836 (ERX1782266-ERR1711948)EnvironmentalOpen in IMG/M
3300019134Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782286-ERR1712165)EnvironmentalOpen in IMG/M
3300019144Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001503 (ERX1789695-ERR1719376)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019151Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789682-ERR1719501)EnvironmentalOpen in IMG/M
3300021877Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021881Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-10 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021886Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030749Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_V_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030787Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_S_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030871Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_R_0.2 metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030921Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_R_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030951Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_Q_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030952Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_Q_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030953Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_S_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030954Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_S_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030958Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_X_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031052Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E4_X_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031063Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_Q_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031126Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_Q_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031445Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_R_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103951_1061689623300008832MarineNNDGSNYEGPLANTGIDQCKSMCSGSGGGCVGWTVTNNNECYLKTSVGDMRSDSGVQGSGYCYPSCGDEQPHQNNDGHNYDGPIQVQNREFCKAKCQAARGQCKGWTVTNDGECYLKDSVGSMRSDSGVQASGYC*
Ga0103882_1005940413300008834Surface Ocean WaterGNNNWGSNYEGPIVNTGTETCKWLCGVSGSNKSTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC*
Ga0103711_1000689313300008928Ocean WaterMKATNSDTKQCWLKDSNLDCSAPDADQQWNTYTSGFCHSACTSLASSSGPSYYCGGIWNGNNNWGSNYDGPIVNTDTDNCKRLCGMSGSNKCTGWTVTNNNECYLKTGVADMQDDPGVQGSGYCYPSCGDQQNKQNNDGRNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC*
Ga0103711_1002263613300008928Ocean WaterVDGKPPLTCCDGYECQQIYGGKKCASNRGPADEETTTALPPSEDVNTTAGDAPTSSLFQGLSSGPSYYCGGTWNQNNNWGSNYGDPIGNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTGVADMQDDPGVQGSGYCYPSCGDQQNKQNNDGRNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC*
Ga0103711_1002358113300008928Ocean WaterLPSFEDVTTTAGDAPTSSLFQGLSSGPSYYCGGTWNQNNNWGSNYGDPIGNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTGVADMQDDPGVQGSGYCYPSCGDQQNKQNNDGRNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC*
Ga0103711_1006728613300008928Ocean WaterTTAGDAPTSSLFQGLSSGPSYYCGGTWNQNNNRGSNYDGPIANTDTEQCKRLCAMSGSKKCTGWTVTNNNECYLKTVVVDMQYDTGVQGSGYCYPSCEDQQNGQNNDGQNYDGPIQVQNAEFCKVRCQASGECRGWTVTNNGECYLKSSVGPMRPDGGVQASGNC*
Ga0103711_1006816213300008928Ocean WaterCKRLCGMSGSNKCTGWTVTNNNECYLKTGVADMQDDPGVQGSGYCYPSCGDQQNKQNNDGRNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC*
Ga0103710_1004231313300009006Ocean WaterVCGGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGECRGWTVTNNGECYLKSSVGPMRSDGGVQASGNC*
Ga0103710_1006032313300009006Ocean WaterVNTTAGDAPTSSLFQGLSSGPSYYCGGTWNQNNNWGSNYGDPIGNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTGVADMQDDPGVQGSGYCYPSCGDQQNKQNNDGRNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC*
Ga0103710_1009196513300009006Ocean WaterEETTTALPPSEDVNTTAGDAPTSSLFQGLSSGPSYYCGGTWNQNNNWGSNYGDPIGNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTGVADMQDDPGVQGSGYCYPSCGDQQNKQNNDGRNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0103707_1020632513300009025Ocean WaterNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC*
Ga0103708_10001415223300009028Ocean WaterVCGSEQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC*
Ga0103878_103294413300009274Surface Ocean WaterNNNDGSNYEGPLANTGIDQCKSMCSGSGGGCVGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNDGECYLKDSVGTMRPDGGVQASGNC*
Ga0103879_1002884913300009276Surface Ocean WaterGNNNWGSNYDGPIVNTDTETCKRLCAMSGSNKCTGWTVTNNNECYLKTSVGDMRSDSGVQGSGYCYPSCGDEQPHQNNDGHNYDGPIQVQNREFCKAKCQAARGQCKGWTVTNNGECYLKDSVGTMRPDGGVQASGNC*
Ga0129277_100866613300009511Meromictic PondMSGSNKCTGWTVTNNNECYLKTSVGDMQSDAGVQGSGYCYPSCGDQQNQQNNDGHNFEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC*
Ga0129360_100528113300009532Meromictic PondMSGSNKCTGWTVTNNNECYLKTSVGDMQSDAGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC*
Ga0115099_1017245113300009543MarineGTYCGGFWGQNNNDGSNFRGPVSNTDPESCKDMCSNAGQGSYDPNKCVGWTVTNNNECYLKTGVGDMQSDTGVQGSGYCYPSCGDQQNGQNNDGQNYDGPIQVQNAEFCKVRCQASGECRGWTVTNNGECYLKSSVEPMRSDGGVQASGNC*
Ga0115105_1140490113300009679MarineMARCLLFIYTVVVAAGQPPQLRGAGPGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC*
Ga0186446_11362613300017113Host-AssociatedSGPNCGPGKAHQYYNTQSDWDSSCSTRVCGSEQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDAGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193510_101269213300018580MarineYYCGGTWNGNNNWGSNYDGPIVNTDTETCKQLCGMSGSNKCTGWTVTNNNECYLKTGVADMQDDPGVQGSGYCYPSCGDQQNKQNKDGRNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193398_100265213300018591MarineSEDVNTTAGDAPTSSLFQGLSSGPSYYCGGTWNQNNNWGSNYGDPIGNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTGVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193339_101822013300018605MarineQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIGNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTGVGDMQSDTGVQGSGYCYPSCGDQQNHQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193339_101981413300018605MarineGYYCGGTWNQNNNWGSNYDGPIGNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTGVGDMQSDTGVQGSGYCYPSCGDQQNHQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193064_101497313300018616MarineQLEQSLTAESYPQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0192914_100781613300018637MarineSANDISGLGKAELQLQGQTTTALPPSEDVNTTAGDAPTSSLFQGLSSGPSYYCGGTWNQNNNWGSNYDGPIGNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0192864_105678913300018639MarineHGEGPIVNTDTETCKWLCSISGSKKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193071_101815313300018645MarineDTETCKQLCGMSGSNKCTGWTVTNNNECYLKTGVADMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGTMRPDGGVQASGNC
Ga0192969_104092013300018649MarinePQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTGVADMQSDTGVQGSGYCYPSCGDQQNQQNNDGQNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0192969_104519913300018649MarineGYYCGGPWNGNNNDGSNYEGPLANTGIDQCKSMCSGSGGGCVGWTVTNNNECYLKTSVGDMRSDSGVQGSGYCYPKCGDEQVSHNNDGNNYAGPIQVQNREFCKVKCQASQGQCKGWTVTNDGDCYLKDSVGSMRSDSGVQASGFC
Ga0193067_105292213300018659MarineTWNGNNNWGSNYDGPIVNTDTETCKWLCSISGSKKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNDGECYLKDSVGTMRPDGGVQASGNC
Ga0193122_103318413300018661MarineDCGSCGDDWNNRMYAPGCQVECSGPNCGPGKAHQYFNTQADWKNSCPTPVCGSAQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKARCQASGGQCKGWTVTNNGECYLKDSVGPMRADGGVQASGNC
Ga0193122_103480613300018661MarineTWGNNRMYAPGCQVECSGPNCGPGKAHQYFNTQADWKNSCPTPVCGSAQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKARCQASGGQCKGWTVTNNGECYLKDSVGPMRADGGVQASGNC
Ga0193013_105832213300018668MarineKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193166_102280213300018674MarineTETCKQLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGTMRPDGGVQASGN
Ga0193384_101731913300018675MarineNDISGLGKAELQLQGQQVAAEETTTALPPSEDVNTTAGDAPTSSLFQGLSSGPSYYCGGTWNGNNNWGSNYDGPIVNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNHQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193137_106033213300018676MarinePIANTDTEQCKRLCAMSGSNKCTGWTVTNNNECYLKNGVGDMQYDTGVQGSGYCYPSCEDQQNNQNNDGQNYDGPIQVQNAEFCKVRCQASGECRGWTVTNNGECYLKSSVGPMRSDGGVQASGNC
Ga0193137_106927213300018676MarineMSGSNKCTGWTVTNNNECYLKTGVADMQSDTGVQGSGYCYPSCGDQQDEQNNDGHNYEGPIQVQNVEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193206_102436213300018681MarineTWAQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIGNTDTDTCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193195_104699813300018699MarineTWGTVTNNNECYLKNGVGDMQYDAGVQGSGYCYPSCEDQQSNQNNNGQNYDGPIPVQNAEFCKVRCQASGECRGWTVTNNGECYLKSSVGPMRPDGGVQASGNC
Ga0193069_105191513300018711MarineKRLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNGQNNDGQNYDGPIQVQNPEFCKARCQASGECRGWTVTNDGECYLKSSVGPMRPDGGVQASGNC
Ga0193038_107701213300018723MarineSNKCTGWTVTNNNECYLKNGVGDMQYDAGVQGSGYCYPSCEDQQSNQNNNGQNYDGPIPVQNAEFCKVRCQASGECRGWTVTNNGECYLKSSVGPMRPDGGVQASGNC
Ga0193534_105387013300018741MarineLSSGPSYYCGGTWNQNNNWGSNYGSPIGNTDTETCKRLCGMSGSNQCTGWTVTNNNECYLKTGVGDMQSDTGVQGSGYCYPSCGDQQDEQNNDGHNYEGPIQVQNVEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193000_103617013300018745MarineAEETTTALPPSEDVNTTAGDAPTSSLFQGLSSGPSYYCGGTWNQNNNWGSNYDGPIGNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTGVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGN
Ga0193468_104978613300018746MarineAGCSGAALLANQSQLEQSLTAESYPQGGLSSAPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKWLCSISGSKKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGTMRPDGGVQASGNC
Ga0193147_105014013300018747MarineKDSNLDCSAPDADQQWNTYTSGFCHSACTSLASSSGPSYYCGGIWNGNNNWGSNYDGPIVNTDTDNCKRLCGMSGSNKCTGWTVTNNNECYLKTGVADMQDDPGVQGSGYCYPSCGDQQNKQNNDGRNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193346_105230613300018754MarineWNGNNNWGSNYEGPIGNTDTDTCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0192924_102593113300018764MarineMGTQADWESSCPSPVCGGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0192924_102616513300018764MarineMGTQADWESSCPSPVCGGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNGQNNDGQNYDGPIQVQNAEFCKARCQASGECRGWTVTNDGECYLKSSVGPMRPDGGVQASGNC
Ga0193396_104443913300018773MarineTTALPPSEDVNTTAGDAPTSGLFQGLSSGPSYYCGGTWNQNNNWGSNYGDPIGNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTGVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193408_104405413300018778MarineTALPPSEDVNTTAGDAPTSSLFQGLSSGPSYYCGGTWNQNNNWGSNYGDPIGNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGECRGWTVTNDGECYLKSSVGPMRPDGGVQASGNC
Ga0192832_103035313300018782MarineHPDPDSSYASPGSGNSEWTLGAPAAVASALRGGLRSGSGYYCGGTWNGNNNDGSNYEGPLANTGIDQCKSMCSGSGGGCVGWTVTNNNECYLKTSVGDMRSDSGVQGSGYCYPSCGDEQPHQNNDGHNYDGPIQVQNREFCKAKCQAARGQCKGWTVTNDGECYLKDSVGSMRSDSGVQASGYC
Ga0192865_1005699913300018795MarineMGGAPAAVASALRGGLRSGSGYYCGGTWNGNNNDGSNYEGPLANTGIDQCKSMCSGSRGGCVGWTVTNNNECYLKISVGDMRSDSGVQGSGYCYPSCGDEQVNQNNDGHNYAGPIQVQNREFCKAKCQASRGQCKGWTVTNDGECYLKGSVGSMRSDSGVQASGFC
Ga0192865_1006617213300018795MarineQRRVHGGNNNWGSNYEGPIVNTDTETCKWLCSISGSKKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0192865_1007072213300018795MarineQRRVHGGNNNWGSNYEGPIVNTDTETCKWLCSISGSKKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRADGGVQASGNC
Ga0193283_100760823300018798MarineLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193397_1001064923300018799MarineWNGNNNDGSNYEGPLANTGIDQCKSMCSGSGGGCVGWTVTNNNECYLKTSVGDMRSDSGVQGSGYCYPSCGDEQPHQNNDGHNYDGPIQVQNREFCKAKCQAARGQCKGWTVTNDGECYLKDSVGSMRSDSGVQASGYC
Ga0193441_108031713300018807MarineGNNNWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193350_106953913300018816MarineAAPAPEHPDPDSSYASPGSGNSEWTLGAPAAVASALRGGLRSGSGYYCGGTWNGNNNDGSNYEGPLANTGIDQCKSMCSGSRGGCVGWTVTNNNECYLKTSVGDMRSDSGVQGSGYCYPSCGDEQVNQNNDGHNYAGPIQVQNREFCKAKCQASRGQCKGWTVTSDGECYLKDSVGSMRSDS
Ga0193366_103674513300018827MarineMGQSDWESSCPTPVCGGEQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193490_106991713300018828MarineYCGGTWNGNNNWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDAGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193312_102659813300018844MarineGCSGPNCGPGKAHQYFNTQADWKNSCPTPVCGSEQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNGQNNDGQNYDGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193312_102959913300018844MarineGKAHQFYNTQSDWESSCPTPVCSSEQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNGQNNDGQNYDGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193475_106561013300018855MarineEGPIVNTDTETCKWLCSISGSKKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGTMRPDGGVQASGNC
Ga0193553_115587313300018873MarineQLCGMSGSNKCTGWTVTNNNECYLKTGVADMQSDAGVQGSGYCYPSCGDQQDKQNNDGHNYEGPIQVQNVEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDDGVQASGNC
Ga0192908_1002325613300018881MarineGLSSGPSYYCGGTWNGNNNWGSNYEGPIGNTDTDTCKWLCGMSGSNKCTGWTVTNNNECYLKTGVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193304_106270513300018888MarineCSGPNCGPGKAHQYFNTQADWKNSCPTPVCGSAQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0192874_1006283913300018904MarineALPPSEDVNTTADDAPTSSLFQGLSSGPSYYCGGTWNQNNNWGSNYEGPIGNTDTLTCKRLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNGQNNDGQNYDGPIQVQNAEFCKARCQASGECRGWTVTNNGECYLKSSVGPMRPDGGVQASGNC
Ga0193083_1004132113300018927MarineGAPAAVASALRGGLRSGSGYYCGGTWNGNNNDGSNYEGPLANTGIDQCKSMCSGSGGGCVGWTVTNNNECYLKTSVGDMRSDSGVQGSGYCYPSCGDEQANQNNDGHNYAGPFQVQNREFCKAKCQASRGQCKGWTVTNDGECYLKDSVGSMRSDSGVQASGFC
Ga0193266_1015641713300018943MarineWGSNYEGPIVNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGTMRPDGGVQASGNC
Ga0193287_108531813300018945MarineEETTTALPPSEDVNTTAGDAPTSSLFQGLSSGPSYYCGGTWNQNNNWGSNYGDPIGNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193528_1025964613300018957MarineTWGNGNNNWGSNYEGPIANTGTDACKHLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDPGVQGSGYCYPTCGDQQNQQNNNGHNYEGPIQVQNAEFCKVKCQASGGQCKGWTVTNNGECYLKDSVEPMKPDGGVQASGYCNPAQ
Ga0193531_1030242013300018961MarineNYEGPIANTGTDACKHLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDPGVQGSGYCYPTCGDQQNQQNNNGHNYEGPIQVQNAEFCKVKCQASGGQCKGWTVTNNGECYLKDSVEPMKPDGGVQASGYCNPAQ
Ga0193087_1015846113300018964MarineLAAEETTTALPPSEDANTTAGVAPTSSLFQGLSSGPSYYCGGTCNGNNNWGSNYDGPIVNTDIETCKGLCAMSGSHKCTGWTVTNNNECYLKNGVGDMQYDAGVQGSGYCYPSCEDQQSNQNNNGQNYDGPIPVQNAEFCKVRCQASGECRGWTVTNNGECYLKSSVGPMRPDEGVQASGNC
Ga0193178_1004119313300018967MarineANQSQLEQSLTAESYPQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKWLCSISGSKKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0192873_1032005713300018974MarineQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKNGVGDMQYDTGVQGSGYCYPSCEDQQSNQNNDGQNYDGPIQVQNAEFCKVRCQASGECRGWTVTNNGECYLKSSVGPMRPDGGVQASGNC
Ga0193006_1015234813300018975MarineQCPASGFCKNTGGLSSAPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193254_1012964713300018976MarineLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGTMRPDGGVQASGNC
Ga0193540_1011882713300018979MarineNCGPGKAHQFYNTQADWESSCPSPVCGGLSSGPSYYCGGTWNGNNNWGSNYDGPIVNTDTETCKQLCGMSGSNKCTGWTVTNNNECYLKTGVADMQSDTGVQGSGYCYPSCGDQQDEQNNDGHNYEGPIQVQNVEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193136_1012573713300018985MarineDEETTTALPPSEDVNTTAGDASTSSLFQGLSSGPSYYCGGTWNQNNNRGSNYDGPIANTDIEQCKRLCAMSGSTKCTGWTVTNNNECYLKTGVEDMQYDTGVQGSGYCYPSCEDQQNNQNNDGQNYDGPIQVQNAEFCKARCQASGECRGWTVTNDGECYLKSSVGPMRPDGGVQASGNC
Ga0193136_1018346313300018985MarineGGLRSGSGYYCGGTWNGNNNDGSNYEGPLANTGIDQCKSMCSGSGGGCVGWTVTNNNECYLKTSVGDMRSDSGVQGSGYCYPSCGDEQPHQNNDGHNYDGPIQVQNREFCKAKCQAARGQCKGWTVTNDGECYLKDSVGSMRSDSGVQASGYC
Ga0193136_1027183213300018985MarineHLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDPGVQGSGYCYPTCGDQQNQQNNNGRNYEGPIQVQNAEFCKVKCQASGGQCKGWTVTNNGECYLKDSVEPMKPDGGVQASGYCNPAQ
Ga0193275_1014914013300018988MarineTWGGPRKAHQYYNTAADWAGSCSTPVCGSVLQQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIANTGTDACKHLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDPGVQGSGYCYPTCGDQQNQQNNNGHNYEGPIQVQNAEFCKVKCQASGGQCDQQR
Ga0193034_1012115113300019001MarineWNQNSNRGSNYDGPIANTDTEQCKRLCAMSGSKKCTGWTVTNNNECYLKTSVWDMQSDTGVQGSGYCYPSCGDQQDEQNNDGHNYEGPIQVQNVEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193034_1013108513300019001MarineNWGSNYDGPIANTDTEQCKRLCAMSGSNKCTGWTVTNNNECYLKNGVGDMQYDTGVQGSGYCYPSCEDQQNGQNNDGQNYDGPIQVQNAEFCKVRCQASGECRGWTVTNNGECYLKSSVGPMRPDGGVQASGNC
Ga0193196_1041243613300019007MarineGGTWNGNNNWGSNYEGPIANTGTDACKHLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDPGVQGSGYCYPTCGDQQNQQNNNGHNYEGPIQVQNAEFCKVKCQASGGQCKGWTVTNNGECYLKDSVEPMKPDGGVQASGYCNPAQ
Ga0193196_1044742613300019007MarinePIVNTDTETCKWLCGVSGSNKCTGWTVTNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193043_1030283613300019012MarineGNNNWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNGQNNDGQNYDGPIQVQNAEFCKARCQASGECRGWTVTNNGECYLKSSVGPMRPDGGVQASGNC
Ga0193043_1033808213300019012MarineGNNNWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNVGECYLKDSVGTMRPDGGVQASGNC
Ga0192982_1029942413300019021MarineHGDQCKSMCSGSGGGCVGWTVTNNNECYLKTSVGDMRSDSGVQGSGYCYPKCGDEQVSHNNDGNNYAGPIQVQNREFCKVKCQASQGQCKGWTVTNDGDCYLKDSVGSMRSDSGVQASGF
Ga0192951_1016228513300019022MarineHGQQIIGGKRCASNRGLAAEETTTALPPSEDVNTTAGDASTSSLFQGLSSGPSYYCGGTWNQNNNWGSNYEGPIGNTDTLTCKRLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNGQNNDGQNYDGPIQVQNAEFCKARCQASGECRGWTVTNNGECYLKSSVGPMRPDGGVQASGNC
Ga0193535_1013932513300019024MarineDCSGCGTDWNNRMYKPGCQVECSGPNCGPGKAHQYYNTAADWAGSCSTPVCGSGLQQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIANTGTDACKRLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDPGVQGSGYCYPTCGDQQNQQNNNGHNYEGPIQVQNAEFCKVKCQASGGQCKGWTVTNNGECYLKDSVEPMKPDGGVQASGYCNPAQ
Ga0192909_1011375213300019027MarineDVNTTAGDAPTSSLFQGLSSGPSYYCGGTWNQNNNWGSNYGDPIGNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0192886_1018213813300019037MarineQGGLSSGPSYYCGGTWNGNNNWGSNYDGPIVNTDIETCKGLCAMSGSHKCTGWTVTNNNECYLKNGVGDMQYDTGVQGSGYCYPSCEDQQNGQNNDGQNYDGPIQVQNAEFCKARCQASGECRGWTVTNDGECYLKSSVGPMRPDGGVQASGNC
Ga0193123_1022991213300019039MarineWNNRMYAPGCQVECSGPNCGPGKAHQFYNTQADWESSCPSPVCGGLSSGPSYYCGGTWNGNNNWGSNYDGPIVNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKARCQASGGQCKGWTVTNNGECYLKDSVGPMRADGGVQASGNC
Ga0193123_1025678713300019039MarinePADEETTTALPPSEDVNTTAGDASTSSLFQGLSSGPSYYCGGTWNQNNNWGSNYGSPIGNTDTETCKRLCGMSGSNQCTGWTVTNNNECYLKTGVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKARCQASGGQCKGWTVTNNGECYLKDSVGPMRADGGVQASGNC
Ga0192857_1027996913300019040MarineTWGPLANTGIDQCKSMCSGSGGGCVGWTVTNDNECYLKTSVGDMRSDSGVQGSGYCYPSCGDEQPHQNNDGHNYDGPIQVQNREFCKAKCQAARGQCKGWTVTNDGECYLKDSVGSMRSDSGVQASGFC
Ga0192981_1028646513300019048MarineSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGQNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193082_1046651613300019049MarineMGSCSTPVCGSGLQQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIANTGTDACKHLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDPGVQGSGYCYPTCGDQQNQQNNNGHNYEGPIQVQNAEFCKVKCQASGGQCKGWTVTNNGECYLKDSVEPMKPDGGVQASGYCNPAQ
Ga0193356_1018951713300019053MarineTWGAGSCSTPVCGSGLQQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIANTGTDACKHLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDPGVQGSGYCYPTCGDQQNQQNNNGHNYEGPIQVQNAEFCKVKCQASGGQCKGWTVTNNGECYLKDSVEPMKPDGGVQASGYCNPAQ
Ga0193459_10367113300019067MarineEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193461_10453913300019068MarineGGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQDGQNNDGHNYDGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193485_10018813300019070MarineLLANQSQLEQSLTAESYPQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDAGVQGSGYCYPSCGDQQNHQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGTMRPDGGVQASGNC
Ga0193541_108970313300019111MarineSGSNKCTGWTVTNNNECYLKTGVADMQSDTGVQGSGYCYPSCGDQQDEQNNDGHNYEGPIQVQNVEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193106_102519913300019112MarineQGGLSSGPSYYCGGTWNGNNNWGSNYDGPIVNTDTETCKQLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0193106_102556813300019112MarineQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIGNTETETCKWLCSISGSKKCTGWTVTNNNECYLKTVVVDMQYDTGVQGSGYCYPSCEDQQNGQNNDGQNYDGPIQVQNAEFCKVRCQASGECRGWTVTNNGECYLKSSVGPMRPDGGVQASGNC
Ga0193515_105304113300019134MarineECSGPNCGPGKAHQYYNTAADWAGSCSTPVCGSGLQQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIANTGTDACKHLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDPGVQGSGYCYPTCGDQQNQQNNNGHNYEGPIQVQNAEFCKVKCQASGGQCKGWTVTNNGECYLKDSVEPMKPDGGVQASGYCNPAQ
Ga0193246_1025575813300019144MarineGVAPTSSLFQGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0194244_1010482013300019150MarineSISASKKCTGWTVTNDNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGIMRPDGGVQASGNC
Ga0192888_1019900613300019151MarineTTALPPSEDVNTTAGDAPTSSLFQGLSSGPSYYCGGTWNQNNNWGSNYGDPIGNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTGVGDMQSDTGVQGSGYCYPSCGDQQNGQNNDGQNYDGPIQVQNAEFCKARCQASGECRGWTVTNDGECYLKSSVGPMRPDGGVQASGNC
Ga0063123_101505313300021877MarineGGLSSAPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKWLCSISGSKKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGTMRPDGGVQASGNC
Ga0063117_101717913300021881MarineTTTALPPSEDVNTTAGDAPTSSLFQGLSSGPSYYCGGTWNQNNNWGSNYDGPIGNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTGVGDMQSDTGVQGSGYCYPSCGDQQNGQNNDGQNYDGPIQVQNAEFCKVRCQASGECRGWTVTNNGECYLKSSVGPMRSDGGVQASGNC
Ga0063114_104645413300021886MarineLSSGPSYYCGGTWNGNNNWGSNYDGPIVNTDTETCKWLCSISGSKKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNVGECYLKDSVGTMRPDGGVQASGNC
Ga0073969_1002874413300030749MarineCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0073965_1178899813300030787MarineQFQCWLKPTIGDKDPSHWAFSANDISGLGKAELQLQGQTTTALPPSEDVNTTAGDAPTSSLFQGLSSGPSYYCGGTWNQNNNWGSNYDGPIGNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTGVGDMQSDTGVQGSGYCYPSCGDQQNGQNNDGQNYDGPIQVQNAEFCKVRCQASGECRGWTVTNNGECYLENSVGPMRPDGGVQASGNC
Ga0151494_109597413300030871MarineGPGKAHQFYNTQSDWESSCPTPVCGSELGGLSSAPSYYCGGTWNGNNNWGSNYEGPIGNTETETCKWLCSISGSKKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTSNGECYLKDSVGPMRPDGGVQASGNC
Ga0073951_1000320613300030921MarineQSQLEQSLTAESYPQGGLSSAPSYYCGGTWNGNNNWGSNYDGPIVNTDTETCKWLCSISGSKKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNDGECYLKDSVGTMRPDGGVQASGNC
Ga0073937_1002026813300030951MarineSGSGYYCGGTWNGNNNDGSNYEGPLANTGIDQCKSMCSGSRGGCVGWTVTNNNECYLKTSVGDMRSDSGVQGSGYCYPSCGDEQVNQNNDGHNYAGPIQVQNREFCKAKCQASRGQCKGWTVTNDGECYLKDSVGSMRSDSGVQASGFC
Ga0073938_1216464413300030952MarineTALPPSEDVNTTAGDAPTSSLFQGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0073941_1001835013300030953MarineWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0073942_1161463013300030954MarineNAAPAPEHPDPDSSYASPGSGNSEWTLGAPAAVASALRGGLRSGSGYYCGGTWNGNNNDGSNYEGPLANTGIDQCKSMCSGSGGGCVGWTVTNNNECYLKTSVGDMRSDSGVQGSGYCYPSCGDEQPHQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0073971_1003578213300030958MarineCAGWSFVYDSSGTDQFQCWLKPTIGDKDPSHWASSANDISGLGKAELQLQGQTTTALPPSEDVNTTAGDAPTSSLFQGLSSGPSYYCGGTWNQNNNWGSNYDGPIGNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTGVGDMQSDTGVQGSGYCYPSCGDQQNGQNNDGQNYDGPIQVQNAEFCKVRCQASGECRGWTVTNNGECYLKSSVGPMRSDGGVQASGNC
Ga0073948_187113413300031052MarineGPNCGPGKAHQFYNTQSDWESSCPTPVCGSEQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGG
Ga0073961_1222475813300031063MarineFVYDSSGTDQFQCWLKPTIGDKDPSHWASSANDISGLGKAELQLQGQTTTALPPSEDVNTTAGDAPTSSLFQGLSSGPSYYCGGTWNQNNNWGSNYDGPIGNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTGVGDMQSDTGVQGSGYCYPSCGDQQNGQNNDGQNYDGPIQVQNAEFCKVRCQASGECRGWTVTNNGECYLKSSVGPMRSDGGVQASGNC
Ga0073962_1196222813300031126MarineNNNWGSNYEGPIVNTDTETCKWLCGVSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
Ga0073952_1128408113300031445MarineSNYDGPIVNTDTETCKWLCSISGSKKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGIMRPDGGVQASGNC
Ga0307387_1050068713300031737MarinePGCQVECSGPNCGPGKAHQYFNTQADWSSSCPTRVCGSEQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDTGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.