x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300017113
3300017113: Metatranscriptome of marine eukaryotic communities from Great South Bay, New York in GSe medium with ammonium, 22 C, 32 psu salinity and 177 ?mol photons light - Aureococcus anophagefferens CCMP 1850 (MMETSP0915)
Overview
Basic Information
IMG/M Taxon OID 3300017113 Open in IMG/M GOLD Reference Gs0128947 | Gp0212158 | Ga0186446 Sample Name Metatranscriptome of marine eukaryotic communities from Great South Bay, New York in GSe medium with ammonium, 22 C, 32 psu salinity and 177 ?mol photons light - Aureococcus anophagefferens CCMP 1850 (MMETSP0915) Sequencing Status Permanent Draft Sequencing Center National Center for Genome Resources Published? N Use Policy Open
Dataset Contents
Total Genome Size 21243868 Sequencing Scaffolds 1 Novel Protein Genes 1 Associated Families 1
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp) Type Host-Associated Taxonomy Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → The Marine Microbial Eukaryote Meta/transcriptome Sequencing Project (mmetsp)
Alternative Ecosystem Assignments
Environment Ontology (ENVO) marine biome → estuary → estuarine water Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
Location Information
Location USA: Great South Bay, Long Island, New York Coordinates Lat. (o ) 40.6508 Long. (o ) -73.1524 Alt. (m) N/A Depth (m) 1 Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F066421 Metatranscriptome 126 N
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0186446_113626 All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Prorocentrales → Prorocentraceae → Prorocentrum → Prorocentrum minimum 567 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0186446_113626 Ga0186446_1136261 F066421 SGPNCGPGKAHQYYNTQSDWDSSCSTRVCGSEQGGLSSGPSYYCGGTWNGNNNWGSNYEGPIVNTDTETCKRLCGMSGSNKCTGWTVTNNNECYLKTSVGDMQSDAGVQGSGYCYPSCGDQQNQQNNDGHNYEGPIQVQNAEFCKVRCQASGGQCKGWTVTNNGECYLKDSVGPMRPDGGVQASGNC
