Metagenome Family F072022

Basic Information
Family ID	F072022
Family Type	Metagenome
Number of Sequences	121
Average Sequence Length	37 residues
Representative Sequence	MMLEEIRITDERMKNSITEERRTHIPHTVSSPALQHV
Number of Associated Samples	5
Number of Associated Scaffolds	106

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Eukaryota
% of genes with valid RBS motifs	61.16 %
% of genes near scaffold ends (potentially truncated)	0.00 %
% of genes from short scaffolds (< 2000 bps)	5.79 %
Associated GOLD sequencing projects	3
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.34

Most Common Taxonomy
Group	Eukaryota (89.256 % of family members)
NCBI Taxonomy ID	2759
Taxonomy	All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules (92.562 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (100.000 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 40.00% β-sheet: 0.00% Coil/Unstructured: 60.00%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 106 Family Scaffolds
PF00078	RVT_1	17.92
PF03732	Retrotrans_gag	12.26
PF00385	Chromo	10.38
PF07727	RVT_2	3.77
PF00665	rve	2.83
PF05056	DUF674	2.83
PF13650	Asp_protease_2	2.83
PF00407	Bet_v_1	1.89
PF13243	SQHop_cyclase_C	1.89
PF03514	GRAS	1.89
PF13456	RVT_3	1.89
PF12384	Peptidase_A2B	1.89
PF01331	mRNA_cap_enzyme	1.89
PF02358	Trehalose_PPase	0.94
PF14226	DIOX_N	0.94
PF11250	FAF	0.94
PF00847	AP2	0.94
PF00400	WD40	0.94
PF00365	PFK	0.94
PF16016	VASt	0.94
PF03939	Ribosomal_L23eN	0.94
PF13975	gag-asp_proteas	0.94
PF02362	B3	0.94
PF00076	RRM_1	0.94
PF00168	C2	0.94
PF03181	BURP	0.94
PF13976	gag_pre-integrs	0.94
PF01789	PsbP	0.94

COG ID	Name	Functional Category	% Frequency in 106 Family Scaffolds
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	2.83
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	2.83
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	2.83
COG4584	Transposase	Mobilome: prophages, transposons [X]	2.83
COG1793	ATP-dependent DNA ligase	Replication, recombination and repair [L]	1.89
COG0205	6-phosphofructokinase	Carbohydrate transport and metabolism [G]	0.94
COG1877	Trehalose-6-phosphate phosphatase	Carbohydrate transport and metabolism [G]	0.94

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	89.26 %
Unclassified	root	N/A	10.74 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	89.26 %
Unclassified	root	N/A	10.74 %

Name	Rank	Taxonomy	Distribution
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	89.26 %
Unclassified	root	N/A	10.74 %

Name	Rank	Taxonomy	Distribution
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	85.95 %
Unclassified	root	N/A	10.74 %

Name	Rank	Taxonomy	Distribution
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	85.95 %
Unclassified	root	N/A	10.74 %

Name	Rank	Taxonomy	Distribution
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	82.64 %
Unclassified	root	N/A	10.74 %

Name	Rank	Taxonomy	Distribution
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	82.64 %
Unclassified	root	N/A	10.74 %

Name	Rank	Taxonomy	Distribution
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	52.07 %
Unclassified	root	N/A	10.74 %

Name	Rank	Taxonomy	Distribution
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	52.07 %
Unclassified	root	N/A	10.74 %

Name	Rank	Taxonomy	Distribution
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	52.07 %
Unclassified	root	N/A	10.74 %

Name	Rank	Taxonomy	Distribution
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	52.07 %
Unclassified	root	N/A	10.74 %

Name	Rank	Taxonomy	Distribution
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	22.31 %
Unclassified	root	N/A	10.74 %

Name	Rank	Taxonomy	Distribution
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	22.31 %
Unclassified	root	N/A	10.74 %

Name	Rank	Taxonomy	Distribution
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	22.31 %
Unclassified	root	N/A	10.74 %

Name	Rank	Taxonomy	Distribution
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	22.31 %
Unclassified	root	N/A	10.74 %

Name	Rank	Taxonomy	Distribution
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	22.31 %
Unclassified	root	N/A	10.74 %

Name	Rank	Taxonomy	Distribution
fabids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids	21.49 %
Unclassified	root	N/A	10.74 %
rosids incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis	0.83 %

Name	Rank	Taxonomy	Distribution
Fabales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales	21.49 %
Unclassified	root	N/A	10.74 %
Vitales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales	0.83 %

Name	Rank	Taxonomy	Distribution
Fabaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	21.49 %
Unclassified	root	N/A	10.74 %
Vitaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae	0.83 %

Name	Rank	Taxonomy	Distribution
Papilionoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae	16.53 %
Unclassified	root	N/A	10.74 %
Viteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae	0.83 %

Name	Rank	Taxonomy	Distribution
50 kb inversion clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade	16.53 %
Unclassified	root	N/A	10.74 %
Vitis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis	0.83 %

Name	Rank	Taxonomy	Distribution
NPAAA clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade	12.40 %
Unclassified	root	N/A	10.74 %
dalbergioids sensu lato	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → dalbergioids sensu lato	4.13 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.83 %

Name	Rank	Taxonomy	Distribution
indigoferoid/millettioid clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade	12.40 %
Unclassified	root	N/A	10.74 %
Dalbergieae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → dalbergioids sensu lato → Dalbergieae	4.13 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.83 %

Name	Rank	Taxonomy	Distribution
Phaseoleae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	12.40 %
Unclassified	root	N/A	10.74 %
Pterocarpus clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → dalbergioids sensu lato → Dalbergieae → Pterocarpus clade	4.13 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.74 %
Glycine	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine	6.61 %
Arachis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → dalbergioids sensu lato → Dalbergieae → Pterocarpus clade → Arachis	4.13 %
Vigna	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna	1.65 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.74 %
Glycine subgen. Soja	subgenus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja	6.61 %
Arachis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → dalbergioids sensu lato → Dalbergieae → Pterocarpus clade → Arachis	4.13 %
Vigna	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna	1.65 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.83 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	10.74 %
Glycine max	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	6.61 %
Arachis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → dalbergioids sensu lato → Dalbergieae → Pterocarpus clade → Arachis	4.13 %
Vigna	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna	1.65 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.83 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300006941\|Ga0099825_1000233	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	51049	Open in IMG/M
3300006941\|Ga0099825_1000233	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	51049	Open in IMG/M
3300006941\|Ga0099825_1001408	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	30636	Open in IMG/M
3300006941\|Ga0099825_1003246	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	21668	Open in IMG/M
3300006941\|Ga0099825_1003472	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	20971	Open in IMG/M
3300006941\|Ga0099825_1004772	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	17660	Open in IMG/M
3300006941\|Ga0099825_1005213	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	16748	Open in IMG/M
3300006941\|Ga0099825_1005355	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	16472	Open in IMG/M
3300006941\|Ga0099825_1005578	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	16081	Open in IMG/M
3300006941\|Ga0099825_1005578	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	16081	Open in IMG/M
3300006941\|Ga0099825_1005752	All Organisms → cellular organisms → Eukaryota	15802	Open in IMG/M
3300006941\|Ga0099825_1007705	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	13024	Open in IMG/M
3300006941\|Ga0099825_1009143	Not Available	11416	Open in IMG/M
3300006941\|Ga0099825_1009150	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	11407	Open in IMG/M
3300006941\|Ga0099825_1009150	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	11407	Open in IMG/M
3300006941\|Ga0099825_1009160	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	11403	Open in IMG/M
3300006941\|Ga0099825_1009160	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	11403	Open in IMG/M
3300006941\|Ga0099825_1010142	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	10427	Open in IMG/M
3300006941\|Ga0099825_1010142	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	10427	Open in IMG/M
3300006941\|Ga0099825_1010862	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	9811	Open in IMG/M
3300006941\|Ga0099825_1011623	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → dalbergioids sensu lato → Dalbergieae → Pterocarpus clade → Arachis	9215	Open in IMG/M
3300006941\|Ga0099825_1012643	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	8487	Open in IMG/M
3300006941\|Ga0099825_1013279	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	8065	Open in IMG/M
3300006941\|Ga0099825_1013445	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7954	Open in IMG/M
3300006941\|Ga0099825_1013569	Not Available	7881	Open in IMG/M
3300006941\|Ga0099825_1013673	All Organisms → cellular organisms → Eukaryota	7820	Open in IMG/M
3300006941\|Ga0099825_1014174	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	7546	Open in IMG/M
3300006941\|Ga0099825_1014316	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7460	Open in IMG/M
3300006941\|Ga0099825_1016353	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	6407	Open in IMG/M
3300006941\|Ga0099825_1019597	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	5005	Open in IMG/M
3300006941\|Ga0099825_1020467	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	4698	Open in IMG/M
3300006941\|Ga0099825_1021634	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	4317	Open in IMG/M
3300006941\|Ga0099825_1021784	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → dalbergioids sensu lato → Dalbergieae → Pterocarpus clade → Arachis	4266	Open in IMG/M
3300006941\|Ga0099825_1021896	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	4230	Open in IMG/M
3300006941\|Ga0099825_1023226	Not Available	3842	Open in IMG/M
3300006941\|Ga0099825_1023583	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	3746	Open in IMG/M
3300006941\|Ga0099825_1027038	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2975	Open in IMG/M
3300006941\|Ga0099825_1030037	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	2451	Open in IMG/M
3300006941\|Ga0099825_1030829	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	2334	Open in IMG/M
3300006941\|Ga0099825_1031685	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2216	Open in IMG/M
3300006941\|Ga0099825_1032345	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	2130	Open in IMG/M
3300006941\|Ga0099825_1038938	Not Available	1489	Open in IMG/M
3300006941\|Ga0099825_1055915	Not Available	751	Open in IMG/M
3300006941\|Ga0099825_1068509	Not Available	538	Open in IMG/M
3300006942\|Ga0099824_1001217	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	35394	Open in IMG/M
3300006942\|Ga0099824_1002786	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	25601	Open in IMG/M
3300006942\|Ga0099824_1006643	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna	15753	Open in IMG/M
3300006942\|Ga0099824_1006987	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	15207	Open in IMG/M
3300006942\|Ga0099824_1011706	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	9819	Open in IMG/M
3300006942\|Ga0099824_1012322	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → dalbergioids sensu lato → Dalbergieae → Pterocarpus clade → Arachis	9363	Open in IMG/M
3300006942\|Ga0099824_1015194	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	7387	Open in IMG/M
3300006942\|Ga0099824_1024346	Not Available	3563	Open in IMG/M
3300006942\|Ga0099824_1027262	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	2792	Open in IMG/M
3300006942\|Ga0099824_1034786	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Vigna	1586	Open in IMG/M
3300006942\|Ga0099824_1038452	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	1273	Open in IMG/M
3300006942\|Ga0099824_1043009	Not Available	1020	Open in IMG/M
3300009763\|Ga0123340_1001173	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	21063	Open in IMG/M
3300009763\|Ga0123340_1003478	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	14790	Open in IMG/M
3300009763\|Ga0123340_1004543	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	13174	Open in IMG/M
3300009763\|Ga0123340_1013829	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	7148	Open in IMG/M
3300009763\|Ga0123340_1016370	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	6286	Open in IMG/M
3300009763\|Ga0123340_1016586	Not Available	6218	Open in IMG/M
3300009763\|Ga0123340_1024212	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	4357	Open in IMG/M
3300009763\|Ga0123340_1026983	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3852	Open in IMG/M
3300009763\|Ga0123340_1035452	Not Available	2667	Open in IMG/M
3300027361\|Ga0209489_100246	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	91759	Open in IMG/M
3300027361\|Ga0209489_100316	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	85158	Open in IMG/M
3300027361\|Ga0209489_100367	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	80420	Open in IMG/M
3300027361\|Ga0209489_100576	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	70663	Open in IMG/M
3300027361\|Ga0209489_100695	All Organisms → cellular organisms → Eukaryota	65674	Open in IMG/M
3300027361\|Ga0209489_100922	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	58833	Open in IMG/M
3300027361\|Ga0209489_100922	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	58833	Open in IMG/M
3300027361\|Ga0209489_101130	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	54259	Open in IMG/M
3300027361\|Ga0209489_101130	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	54259	Open in IMG/M
3300027361\|Ga0209489_101151	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	53707	Open in IMG/M
3300027361\|Ga0209489_101153	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	53682	Open in IMG/M
3300027361\|Ga0209489_101153	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	53682	Open in IMG/M
3300027361\|Ga0209489_101243	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	52086	Open in IMG/M
3300027361\|Ga0209489_101243	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	52086	Open in IMG/M
3300027361\|Ga0209489_101270	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	51510	Open in IMG/M
3300027361\|Ga0209489_101341	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	50364	Open in IMG/M
3300027361\|Ga0209489_101641	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	46012	Open in IMG/M
3300027361\|Ga0209489_102348	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	38634	Open in IMG/M
3300027361\|Ga0209489_102894	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	34277	Open in IMG/M
3300027361\|Ga0209489_103294	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	31733	Open in IMG/M
3300027361\|Ga0209489_103391	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	31171	Open in IMG/M
3300027361\|Ga0209489_103765	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	29008	Open in IMG/M
3300027361\|Ga0209489_103765	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	29008	Open in IMG/M
3300027361\|Ga0209489_104076	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	27440	Open in IMG/M
3300027361\|Ga0209489_104482	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	25631	Open in IMG/M
3300027361\|Ga0209489_104748	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	24654	Open in IMG/M
3300027361\|Ga0209489_104748	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	24654	Open in IMG/M
3300027361\|Ga0209489_105033	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	23546	Open in IMG/M
3300027361\|Ga0209489_105064	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	23437	Open in IMG/M
3300027361\|Ga0209489_105898	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	20498	Open in IMG/M
3300027361\|Ga0209489_105912	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	20449	Open in IMG/M
3300027361\|Ga0209489_105912	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	20449	Open in IMG/M
3300027361\|Ga0209489_106030	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	20030	Open in IMG/M
3300027361\|Ga0209489_106030	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	20030	Open in IMG/M
3300027361\|Ga0209489_109144	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	12630	Open in IMG/M
3300027361\|Ga0209489_109595	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → dalbergioids sensu lato → Dalbergieae → Pterocarpus clade → Arachis	11839	Open in IMG/M
3300027361\|Ga0209489_109894	Not Available	11341	Open in IMG/M
3300027361\|Ga0209489_110470	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	10422	Open in IMG/M
3300027361\|Ga0209489_110478	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	10406	Open in IMG/M
3300027361\|Ga0209489_110478	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	10406	Open in IMG/M
3300027361\|Ga0209489_110907	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	9753	Open in IMG/M
3300027361\|Ga0209489_111112	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → dalbergioids sensu lato → Dalbergieae → Pterocarpus clade → Arachis	9473	Open in IMG/M
3300027361\|Ga0209489_111376	All Organisms → cellular organisms → Eukaryota	9121	Open in IMG/M
3300027361\|Ga0209489_112696	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	7422	Open in IMG/M
3300027361\|Ga0209489_114983	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	5049	Open in IMG/M
3300027361\|Ga0209489_114983	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae → Glycine → Glycine subgen. Soja → Glycine max	5049	Open in IMG/M
3300027363\|Ga0209700_100168	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	102823	Open in IMG/M
3300027363\|Ga0209700_100384	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → indigoferoid/millettioid clade → Phaseoleae	80110	Open in IMG/M
3300027363\|Ga0209700_100462	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	75669	Open in IMG/M
3300027363\|Ga0209700_102172	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	40196	Open in IMG/M
3300027363\|Ga0209700_104890	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	23428	Open in IMG/M
3300027363\|Ga0209700_104948	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae	23238	Open in IMG/M
3300027363\|Ga0209700_106636	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	17603	Open in IMG/M
3300027363\|Ga0209700_106978	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	16660	Open in IMG/M
3300027363\|Ga0209700_113716	Not Available	5589	Open in IMG/M
3300027363\|Ga0209700_122957	Not Available	1029	Open in IMG/M

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.34
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.34
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F072022

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300006941	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW	Host-Associated	Open in IMG/M
3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Host-Associated	Open in IMG/M
3300009763	Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix	Host-Associated	Open in IMG/M
3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes)	Host-Associated	Open in IMG/M
3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes)	Host-Associated	Open in IMG/M

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0099825_100023310	3300006941	Root Nodules	MMLEEIRITDERMKNSITEERRTHIPHIVSSPALQHV*
Ga0099825_100023315	3300006941	Root Nodules	MMLEEIRIIDERMKNSITDERMKNSITEERRTHIPHTVSSPALQHV*
Ga0099825_100140813	3300006941	Root Nodules	MLEEIRIANERMKNSITEERRTHIPHTVSSPALQHV*
Ga0099825_100324639	3300006941	Root Nodules	MLEETRITDERMKNSVTKERRTHIPHIITPPALLTCILL*
Ga0099825_10034722	3300006941	Root Nodules	MLEEIRIVDERKKNSITEERRTTHIPHTVSSPTL*
Ga0099825_100477223	3300006941	Root Nodules	MLEEIRIADERMKNSITEKRRTTHIPHIVSSPALQHI*
Ga0099825_10052131	3300006941	Root Nodules	MMLEEIRIVNERMKNSITEERRTHIPHTLSPPALLACIIL*
Ga0099825_100535527	3300006941	Root Nodules	MLEEIGIADERKKNSITKERRTTHIPHTISSATLHHV*
Ga0099825_100557815	3300006941	Root Nodules	MLEEIRIADERMNNSITEERKITHIPHTVSSPALQHV*
Ga0099825_100557821	3300006941	Root Nodules	MTLEEIRIADERMKNSIIEERRTTHISHTVSSPALQHV*
Ga0099825_10057523	3300006941	Root Nodules	MLEEIGIADERKKNSITEERRITHISHTVSSPTLQHV*
Ga0099825_100770511	3300006941	Root Nodules	MLEEIRITDERMKNSITEERRTHISHTVSSPALQQV*
Ga0099825_10091434	3300006941	Root Nodules	MMLEEIRIANERMKSSITEERRTTHTLNTVSSPALQHV*
Ga0099825_100915012	3300006941	Root Nodules	MMLEEIGITEERMKNSIIEKRRTHIPHTVSSLALQHV*
Ga0099825_100915019	3300006941	Root Nodules	MMLEEIGIVDEGMKNLITEERRTNIPHTVSSPALQHV*
Ga0099825_100916015	3300006941	Root Nodules	MMLEEIRITDKRMKNSITEERRTHIPHNVSSPALQHV*
Ga0099825_10091608	3300006941	Root Nodules	MMLEEIRITDERMKNSITEERRTHIPHTISSPAL*
Ga0099825_101014212	3300006941	Root Nodules	MMLEEIRIADERIKNSITEERITHIPHTVSSPALLAGTIL*
Ga0099825_10101426	3300006941	Root Nodules	MMLEEIRIADERMKNSIIEERRTHIPQTVSSPALLACVIL*
Ga0099825_10108623	3300006941	Root Nodules	MILEEIRITDERMKNSITEERRTHIPHTISAPALQQV*
Ga0099825_10116234	3300006941	Root Nodules	MMLEEIRIADERLKNSMTEEKRTTHIPHNVSSPALQHI*
Ga0099825_101264311	3300006941	Root Nodules	MMLEEIRITDERMKNSITEERRTHIPHTVSSPALQHV*
Ga0099825_10132794	3300006941	Root Nodules	MILEEIRITDERMKNSITERRTHIPYIVSSPVLQQV*
Ga0099825_10134455	3300006941	Root Nodules	MMLEEIRIADERMKNSITEERRTTHISYTVSSPALQHV*
Ga0099825_10135696	3300006941	Root Nodules	MLKEIRITDERMKNSITEKNKTIHIPNDVSSPILQYI*
Ga0099825_101367312	3300006941	Root Nodules	VILEEIRITDERMQNSITEERRTHIPHTVHSPALQ*
Ga0099825_10141749	3300006941	Root Nodules	MMLEEIRIIDERMKNSITEERITHILHTVSSPALQHI*
Ga0099825_101431615	3300006941	Root Nodules	MLEEIKIADERMKNSIIEERRTHIPHTVSLLALLACIIL*
Ga0099825_10163534	3300006941	Root Nodules	MKLEEIRITYERIKNSIIEERRTHISHIISPPALLACIIL*
Ga0099825_10195972	3300006941	Root Nodules	MLEEIRITDERMKNSITEERRTHISHTVSSPALQ*
Ga0099825_10204671	3300006941	Root Nodules	MRITIKMMLEEIRITNERMKNSITEERRTHIPHTVPSPTLQHV*
Ga0099825_10216341	3300006941	Root Nodules	MMLEEIRTADERMKNSITEERRTHIPYTVSSPAL*
Ga0099825_10217846	3300006941	Root Nodules	MILEEIRITDERMKNTITEERRTHIPHTVSSPALPHV*
Ga0099825_10218965	3300006941	Root Nodules	MILEEIRIANERMKNSITEERRTTHIPYPVSSPALQHV*
Ga0099825_10232263	3300006941	Root Nodules	MMLEEIRITDERMKNSITEERRTHIPHTVSSPVLQQV*
Ga0099825_10235835	3300006941	Root Nodules	MVLEEIRIADERMKNSITEERRTTHIPHTVSSPTL*
Ga0099825_10270383	3300006941	Root Nodules	MMLEEIRITDERMKNSIIEERRIHIPHPVSSPALQNV*
Ga0099825_10300371	3300006941	Root Nodules	MMLEEIRITDERMKNPITEERRTHIPHIVSFPVLQQV*
Ga0099825_10308293	3300006941	Root Nodules	MILEEIRITDERMKNSIIEERRTHIPHTVSSPALQQV*
Ga0099825_10316854	3300006941	Root Nodules	MLEEIRITDERMKNSITEERRIHIPHPVSSPALQHV*
Ga0099825_10323453	3300006941	Root Nodules	MLEEIGIADERKKNSITEERRTTHIPHTVSSPTLQHV*
Ga0099825_10389382	3300006941	Root Nodules	MMLEEIRIADERMKNSITEERRTTHIPHTVSSHTLQHV*
Ga0099825_10559151	3300006941	Root Nodules	MILEEIRITDERMKNSITEERRTHIPHTVPSPALQ*
Ga0099825_10685092	3300006941	Root Nodules	MMLEEIRIADERMKNSITEKRRTTHIPHTVSSPVL*
Ga0099824_10012178	3300006942	Root Nodules	MMLEEIRIVNERMKNSIIEEKRTHIPQTVSSPALLVCIIL*
Ga0099824_100278639	3300006942	Root Nodules	MMLEEIRIADERMKNSITKERRTTHIPHTVSSPTLQHV*
Ga0099824_100664330	3300006942	Root Nodules	MMLEEIRIADERMKNSITEERRTTHIPHTVSSPTLQHV*
Ga0099824_10069875	3300006942	Root Nodules	MMLEEIRITDERMKNSITGERRIHILHIVSSPALQQV*
Ga0099824_10117066	3300006942	Root Nodules	MMLEEIRITDERMKNSITKERRTRIPHTVSSPALQQV*
Ga0099824_10123222	3300006942	Root Nodules	MMLEEIRIADERMKNSMTEEKRTTHIPHNVSSPTLQHI*
Ga0099824_101519411	3300006942	Root Nodules	MVLEEIRIADERMKNSITEERRTTHIPHTVSSPAL*
Ga0099824_10243463	3300006942	Root Nodules	MLEEIRITDERMKNSITEERRTHIPHTVSSPVLQQV*
Ga0099824_10272622	3300006942	Root Nodules	MLEEIRIVDERKKNSITEERRTTHIPHPVSSPTLQHV*
Ga0099824_10347862	3300006942	Root Nodules	MILEEIRITDERMKNSITEERRTHIPHSVSSPALQ*
Ga0099824_10384524	3300006942	Root Nodules	MMLEEIRITDERMKNSITEERRTHITHTVSSPALQQV*
Ga0099824_10430092	3300006942	Root Nodules	MMLEEIRIADERIKNSITEKRRTTHIPHTVSSPVLQHV*
Ga0123340_100117315	3300009763	Root Nodule	MLEEIRITDERMKNSITEERRTHIPHTVSSPSLQHV*
Ga0123340_100347812	3300009763	Root Nodule	MLEEIRITDERMKNSITEERRTHIPHIVSSPALQHV*
Ga0123340_10045438	3300009763	Root Nodule	MRITTRMILKEIKIADERMKNSITEEMRTQIPHPISSPALQHV*
Ga0123340_10138298	3300009763	Root Nodule	MLEEIRITDERMKNSITKERRTHISHTVSSPALQQV*
Ga0123340_10163707	3300009763	Root Nodule	MMLEEIRIADERMKNSITEKRRTTHIPHIVSSPALQHI*
Ga0123340_10165861	3300009763	Root Nodule	MMLKEIRITDERMKNSITEKNKTIHIPNDVSSPILQYI*
Ga0123340_10242123	3300009763	Root Nodule	MMLEENGITDERMKNSITKEMRTHISHTVSFSALQHV*
Ga0123340_10269831	3300009763	Root Nodule	MMLEEIRIANERMKNSITEERRTHIPHTVSSPALQHV*
Ga0123340_10354521	3300009763	Root Nodule	MMLEEIRITDKRLKNSITEERRTHIPHTVSSPALQQV*
Ga0209489_10024672	3300027361	Root Nodules	MMLEENGITDERMKNSITKEMRTHISHTVSFSALQHV
Ga0209489_10031632	3300027361	Root Nodules	MRITTRMILKEIKIADERMKNSITEEMRTQIPHPISSPALQHV
Ga0209489_10036762	3300027361	Root Nodules	MMLEEIRIADERMKNSITEKRRTHILHTISSPALQHV
Ga0209489_10057616	3300027361	Root Nodules	MMLEEIRIADERMKNSITEKRRTTHIPHIVSSPALQHI
Ga0209489_10069519	3300027361	Root Nodules	MLEEIRITDERMKNSITEERRTHIPHTVSSPSLQHV
Ga0209489_10092233	3300027361	Root Nodules	MMLEEIRITDERMKNSITEERRTHIPHTVSSPVLQQV
Ga0209489_10092240	3300027361	Root Nodules	MMLEEIRITDERMKNSITGERRIHILHIVSSPALQQV
Ga0209489_1011302	3300027361	Root Nodules	MLEEIGIADERKKNSITEERRTTHIPHTVSSPTLQHV
Ga0209489_1011306	3300027361	Root Nodules	MLEEIGIADERKKNSITKERRTTHIPHTISSATLHHV
Ga0209489_10115130	3300027361	Root Nodules	MMLEEIRIADERLKNSMTEEKRTTHIPHNVSSPALQHI
Ga0209489_10115333	3300027361	Root Nodules	MTLEEIRIADERMKNSIIEERRTTHISHTVSSPALQHV
Ga0209489_10115339	3300027361	Root Nodules	MLEEIRIADERMNNSITEERKITHIPHTVSSPALQHV
Ga0209489_1012431	3300027361	Root Nodules	MMLEEIRITDERMKNSITEERRTHISHTVSSPALQ
Ga0209489_1012433	3300027361	Root Nodules	MMLEEIRITDERMKNSITKERRTHISHTVSSPALQQV
Ga0209489_10127022	3300027361	Root Nodules	MMLEEIRIVNERMKNSIIEEKRTHIPQTVSSPALLVCIIL
Ga0209489_10134116	3300027361	Root Nodules	MLEEIRIANERMKNSITEERRTHIPHTVSSPALQHV
Ga0209489_10164131	3300027361	Root Nodules	MMLEEIRIADERMKNSITEEKRTTHIPHNVSSLILQHI
Ga0209489_10234821	3300027361	Root Nodules	MLEEIGIADERKKNSITEERRITHISHTVSSPTLQHV
Ga0209489_10289432	3300027361	Root Nodules	MMLEEIRIADERMKNSITEERRTTHIPHTVSSPTLQHV
Ga0209489_10329414	3300027361	Root Nodules	MLEEIRITDERMKNSITEERRTHIPHTVSSPALQHV
Ga0209489_10339124	3300027361	Root Nodules	MILEEIRITDERMKNTITEERRTHIPHTVSSPALPHV
Ga0209489_10376514	3300027361	Root Nodules	MMLEEIRIIDERMKNSITDERMKNSITEERRTHIPHTVSSPALQHV
Ga0209489_10376520	3300027361	Root Nodules	MLEEIRITDERMKNSITEERRTHIPHIVSSPALQHV
Ga0209489_10407611	3300027361	Root Nodules	MILEEIRITDERMKNSITEERRTHIPHTVPSPALQ
Ga0209489_1044826	3300027361	Root Nodules	MILEEIRITDERMKNSITERRTHIPYIVSSPVLQQV
Ga0209489_10474810	3300027361	Root Nodules	MMLEEIRITDERMKNSITEERRTHITHTVSSPALQQV
Ga0209489_1047483	3300027361	Root Nodules	MMLEEIRITDKRLKNSITEERRTHIPHTVSSPALQQV
Ga0209489_1050339	3300027361	Root Nodules	MILEEIRITDERMKNSITEERRTHIPHTISAPALQQV
Ga0209489_10506410	3300027361	Root Nodules	MLEEIKIADERMKNSIIEERRTHIPHTVSLLALLACIIL
Ga0209489_10589816	3300027361	Root Nodules	MRITIKMMLEEIRITNERMKNSITEERRTHIPHTVPSPTLQHV
Ga0209489_10591215	3300027361	Root Nodules	MMLEEIGIVDEGMKNLITEERRTNIPHTVSSPALQHV
Ga0209489_1059127	3300027361	Root Nodules	MMLEEIGITEERMKNSIIEKRRTHIPHTVSSLALQHV
Ga0209489_10603010	3300027361	Root Nodules	MLEEIRITDERMKNSITEERRTHISHTVSSPALQQV
Ga0209489_10603015	3300027361	Root Nodules	MMLEEIRITDERMKNSITKERRTRIPHTVSSPALQQV
Ga0209489_10914410	3300027361	Root Nodules	MMLEEIRITDKRMKNSITEERRTHIPHNVSSPALQHV
Ga0209489_1095956	3300027361	Root Nodules	MILEEIRIANERMKNSITEERRTTHIPYPVSSPALQHV
Ga0209489_1098946	3300027361	Root Nodules	MMLEEIRIANERMKSSITEERRTTHTLNTVSSPALQHV
Ga0209489_11047010	3300027361	Root Nodules	VILEEIRITDERMQNSITEERRTHIPHTVHSPALQ
Ga0209489_1104782	3300027361	Root Nodules	MMLEEIRIADERIKNSITEERITHIPHTVSSPALLAGTIL
Ga0209489_1104788	3300027361	Root Nodules	MMLEEIRIADERMKNSIIEERRTHIPQTVSSPALLACVIL
Ga0209489_1109076	3300027361	Root Nodules	MILEEIRITDERMKNSIIEERRTHIPHTVSSPALQQV
Ga0209489_1111125	3300027361	Root Nodules	MKLEEIRITYERIKNSIIEERRTHISHIISPPALLACIIL
Ga0209489_1113769	3300027361	Root Nodules	MVLEEIRIADERMKNSITEERRTTHIPHTVSSPTL
Ga0209489_1126962	3300027361	Root Nodules	MILEEIRITDERMKNSITEERRTHIPHSVSSPALQ
Ga0209489_1149831	3300027361	Root Nodules	MMLEEIRITDERMKNSIIEERRIHIPHPVSSPALQNV
Ga0209489_1149837	3300027361	Root Nodules	MLEEIRITDERMKNSITEERRIHIPHPVSSPALQHV
Ga0209700_10016845	3300027363	Root Nodules	MVLEEIRITDERMKNSIIEERRTHIPHTVSSPILQHV
Ga0209700_10038432	3300027363	Root Nodules	MLEEIRIADERMKNSITEKRRTTHIPHIVSSPALQHI
Ga0209700_10046237	3300027363	Root Nodules	MLEEIRITDERMKNSITKERRTHISHTVSSPALQQV
Ga0209700_10217213	3300027363	Root Nodules	MMLEEIRITDERMKNSITEERRTHIPHIVSSPALQHV
Ga0209700_1048909	3300027363	Root Nodules	MMLEEIRIANERMKNSITEERRTHIPHTVSSPALQHV
Ga0209700_1049486	3300027363	Root Nodules	MMLEEIRIIDERMKNSITEERITHILHTVSSPALQHI
Ga0209700_1066368	3300027363	Root Nodules	MMLEEIRITDERMKNSITEERRTHIPHTVSSPALQHV
Ga0209700_1069785	3300027363	Root Nodules	MMLKEIRITDERMKKSITEERKTHIPYTVSSPAFQQV
Ga0209700_1137161	3300027363	Root Nodules	MLEEIRITDERMKNSITEERRTHIPHTVSSPVLQQV
Ga0209700_1229571	3300027363	Root Nodules	MMLEEIRIADERMKNSITEKRRTTHIPHTVSSPVL

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign