NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F079563

Metatranscriptome Family F079563

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F079563
Family Type Metatranscriptome
Number of Sequences 115
Average Sequence Length 99 residues
Representative Sequence MKKYSNLRQMGGEELGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGETGSFRHGDLRWVFG
Number of Associated Samples 77
Number of Associated Scaffolds 115

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 31.30 %
% of genes near scaffold ends (potentially truncated) 10.43 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 68
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(86.957 % of family members)
Environment Ontology (ENVO) Unclassified
(89.565 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(99.130 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.12%    β-sheet: 38.14%    Coil/Unstructured: 57.73%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 115 Family Scaffolds
PF00504Chloroa_b-bind 1.74


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300008832|Ga0103951_10564151All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis619Open in IMG/M
3300008832|Ga0103951_10803397All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis512Open in IMG/M
3300008998|Ga0103502_10182474All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis765Open in IMG/M
3300008998|Ga0103502_10280011All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis614Open in IMG/M
3300008998|Ga0103502_10286127All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis607Open in IMG/M
3300009022|Ga0103706_10047469All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis882Open in IMG/M
3300009028|Ga0103708_100215304All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis567Open in IMG/M
3300009216|Ga0103842_1015183All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis729Open in IMG/M
3300009216|Ga0103842_1017410All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis703Open in IMG/M
3300009269|Ga0103876_1056622All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis569Open in IMG/M
3300009316|Ga0103840_100886All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis514Open in IMG/M
3300009333|Ga0103833_1004320All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis537Open in IMG/M
3300009606|Ga0115102_10494684All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis517Open in IMG/M
3300010981|Ga0138316_10488274All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis530Open in IMG/M
3300010987|Ga0138324_10156637All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis1023Open in IMG/M
3300010987|Ga0138324_10644481All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis531Open in IMG/M
3300010987|Ga0138324_10661013All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis525Open in IMG/M
3300018504|Ga0193465_104887All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis590Open in IMG/M
3300018504|Ga0193465_104955All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis586Open in IMG/M
3300018518|Ga0193462_106457All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis585Open in IMG/M
3300018581|Ga0193079_1012629All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis545Open in IMG/M
3300018584|Ga0193340_1015885All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis526Open in IMG/M
3300018588|Ga0193141_1013282All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis626Open in IMG/M
3300018588|Ga0193141_1013439All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis623Open in IMG/M
3300018604|Ga0193447_1020184All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis603Open in IMG/M
3300018604|Ga0193447_1023630All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis557Open in IMG/M
3300018611|Ga0193316_1024762All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis633Open in IMG/M
3300018611|Ga0193316_1029742All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis569Open in IMG/M
3300018641|Ga0193142_1066283All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis502Open in IMG/M
3300018644|Ga0193352_1052635All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis512Open in IMG/M
3300018651|Ga0192937_1033554All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis600Open in IMG/M
3300018652|Ga0192993_1032983All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis513Open in IMG/M
3300018655|Ga0192846_1032351All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis551Open in IMG/M
3300018657|Ga0192889_1055227All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis544Open in IMG/M
3300018660|Ga0193130_1036210All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis641Open in IMG/M
3300018666|Ga0193159_1046471All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis557Open in IMG/M
3300018678|Ga0193007_1044718All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis604Open in IMG/M
3300018686|Ga0192840_1040985All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis575Open in IMG/M
3300018686|Ga0192840_1047434All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis534Open in IMG/M
3300018686|Ga0192840_1052726All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis505Open in IMG/M
3300018690|Ga0192917_1053620All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis602Open in IMG/M
3300018701|Ga0193405_1046542All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis504Open in IMG/M
3300018704|Ga0192954_1042117All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis616Open in IMG/M
3300018708|Ga0192920_1080390All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis530Open in IMG/M
3300018709|Ga0193209_1060741All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis530Open in IMG/M
3300018720|Ga0192866_1071546All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis520Open in IMG/M
3300018731|Ga0193529_1058873All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis692Open in IMG/M
3300018731|Ga0193529_1067071All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis636Open in IMG/M
3300018733|Ga0193036_1049286All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis614Open in IMG/M
3300018747|Ga0193147_1065356All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis607Open in IMG/M
3300018752|Ga0192902_1081549All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis570Open in IMG/M
3300018752|Ga0192902_1083447All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis561Open in IMG/M
3300018752|Ga0192902_1088251All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis540Open in IMG/M
3300018752|Ga0192902_1094149All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis516Open in IMG/M
3300018769|Ga0193478_1060633All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis608Open in IMG/M
3300018769|Ga0193478_1063071All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis594Open in IMG/M
3300018769|Ga0193478_1066961All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis574Open in IMG/M
3300018769|Ga0193478_1069022All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis564Open in IMG/M
3300018770|Ga0193530_1088569All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis573Open in IMG/M
3300018798|Ga0193283_1071057All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis534Open in IMG/M
3300018801|Ga0192824_1103475All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis524Open in IMG/M
3300018816|Ga0193350_1076553All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis518Open in IMG/M
3300018836|Ga0192870_1091280All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis510Open in IMG/M
3300018837|Ga0192927_1023746All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis914Open in IMG/M
3300018852|Ga0193284_1052494All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis632Open in IMG/M
3300018852|Ga0193284_1065378All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis570Open in IMG/M
3300018852|Ga0193284_1080668All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis515Open in IMG/M
3300018854|Ga0193214_1090247All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis560Open in IMG/M
3300018859|Ga0193199_1107231All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis586Open in IMG/M
3300018859|Ga0193199_1121423All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis536Open in IMG/M
3300018861|Ga0193072_1096404All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis566Open in IMG/M
3300018872|Ga0193162_1089981All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis587Open in IMG/M
3300018872|Ga0193162_1103086All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis539Open in IMG/M
3300018905|Ga0193028_1109773All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis532Open in IMG/M
3300018908|Ga0193279_1124087All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis520Open in IMG/M
3300018908|Ga0193279_1124088All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis520Open in IMG/M
3300018929|Ga0192921_10177478All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis645Open in IMG/M
3300018930|Ga0192955_10149008All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis600Open in IMG/M
3300018930|Ga0192955_10149011All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis600Open in IMG/M
3300018947|Ga0193066_10165386All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis641Open in IMG/M
3300018947|Ga0193066_10224023All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis530Open in IMG/M
3300018957|Ga0193528_10255320All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis605Open in IMG/M
3300018957|Ga0193528_10275845All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis571Open in IMG/M
3300018957|Ga0193528_10316357All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis513Open in IMG/M
3300018957|Ga0193528_10316395All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis513Open in IMG/M
3300018961|Ga0193531_10279551All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis586Open in IMG/M
3300018969|Ga0193143_10182541All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis611Open in IMG/M
3300018969|Ga0193143_10212797All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis554Open in IMG/M
3300018987|Ga0193188_10077461All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis550Open in IMG/M
3300018987|Ga0193188_10077719All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis549Open in IMG/M
3300018988|Ga0193275_10164953All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis679Open in IMG/M
3300018989|Ga0193030_10258366All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis570Open in IMG/M
3300018999|Ga0193514_10252483All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis616Open in IMG/M
3300019011|Ga0192926_10044861All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis1510Open in IMG/M
3300019011|Ga0192926_10044934All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis1509Open in IMG/M
3300019016|Ga0193094_10247796All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis585Open in IMG/M
3300019017|Ga0193569_10371860All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis562Open in IMG/M
3300019020|Ga0193538_10220359All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis632Open in IMG/M
3300019020|Ga0193538_10220383All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis632Open in IMG/M
3300019020|Ga0193538_10232950All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis606Open in IMG/M
3300019020|Ga0193538_10257616All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis561Open in IMG/M
3300019024|Ga0193535_10246648All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis554Open in IMG/M
3300019036|Ga0192945_10264284All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis542Open in IMG/M
3300019044|Ga0193189_10119402All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis631Open in IMG/M
3300019103|Ga0192946_1050833All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis615Open in IMG/M
3300019143|Ga0192856_1048891All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis602Open in IMG/M
3300019150|Ga0194244_10109901All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis528Open in IMG/M
3300019152|Ga0193564_10184149All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis638Open in IMG/M
3300019152|Ga0193564_10188929All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis627Open in IMG/M
3300019152|Ga0193564_10229787All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis547Open in IMG/M
3300019152|Ga0193564_10230350All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis546Open in IMG/M
3300021862|Ga0063112_102239All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis530Open in IMG/M
3300021883|Ga0063126_1010351All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis561Open in IMG/M
3300021886|Ga0063114_1011089All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis506Open in IMG/M
3300031739|Ga0307383_10676390All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Siphonostomatoida → Caligidae → Lepeophtheirus → Lepeophtheirus salmonis525Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine86.96%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine6.96%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water3.48%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water1.74%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.87%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008998Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_A100000548EnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009028Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S3EnvironmentalOpen in IMG/M
3300009216Microbial communities of water from the North Atlantic ocean - ACM47EnvironmentalOpen in IMG/M
3300009269Eukaryotic communities of water from the North Atlantic ocean - ACM28EnvironmentalOpen in IMG/M
3300009316Microbial communities of water from the North Atlantic ocean - ACM15EnvironmentalOpen in IMG/M
3300009333Microbial communities of water from the North Atlantic ocean - ACM52EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300018504Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002418 (ERX1782261-ERR1712132)EnvironmentalOpen in IMG/M
3300018518Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002416 (ERX1782323-ERR1711987)EnvironmentalOpen in IMG/M
3300018581Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_051 - TARA_N000000225 (ERX1782098-ERR1712053)EnvironmentalOpen in IMG/M
3300018584Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001758 (ERX1789699-ERR1719170)EnvironmentalOpen in IMG/M
3300018588Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000538 (ERX1782191-ERR1712140)EnvironmentalOpen in IMG/M
3300018604Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002362 (ERX1782200-ERR1712077)EnvironmentalOpen in IMG/M
3300018611Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001660 (ERX1782173-ERR1712095)EnvironmentalOpen in IMG/M
3300018641Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782156-ERR1711909)EnvironmentalOpen in IMG/M
3300018644Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782112-ERR1712144)EnvironmentalOpen in IMG/M
3300018651Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_078 - TARA_N000001512 (ERX1782264-ERR1711863)EnvironmentalOpen in IMG/M
3300018652Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001590 (ERX1782207-ERR1711900)EnvironmentalOpen in IMG/M
3300018655Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000522 (ERX1782387-ERR1711943)EnvironmentalOpen in IMG/M
3300018657Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000705 (ERX1789382-ERR1719418)EnvironmentalOpen in IMG/M
3300018660Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000589 (ERX1782392-ERR1711993)EnvironmentalOpen in IMG/M
3300018666Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000398 (ERX1782307-ERR1712184)EnvironmentalOpen in IMG/M
3300018678Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782149-ERR1712036)EnvironmentalOpen in IMG/M
3300018686Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000593 (ERX1789430-ERR1719415)EnvironmentalOpen in IMG/M
3300018690Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000839 (ERX1782228-ERR1712109)EnvironmentalOpen in IMG/M
3300018701Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002017 (ERX1789579-ERR1719459)EnvironmentalOpen in IMG/M
3300018704Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782253-ERR1711956)EnvironmentalOpen in IMG/M
3300018708Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000843 (ERX1782185-ERR1711899)EnvironmentalOpen in IMG/M
3300018709Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782278-ERR1712213)EnvironmentalOpen in IMG/M
3300018720Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000793 (ERX1789656-ERR1719302)EnvironmentalOpen in IMG/M
3300018731Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782345-ERR1712158)EnvironmentalOpen in IMG/M
3300018733Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782259-ERR1711890)EnvironmentalOpen in IMG/M
3300018747Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000696 (ERX1782435-ERR1712076)EnvironmentalOpen in IMG/M
3300018752Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000662 (ERX1789652-ERR1719340)EnvironmentalOpen in IMG/M
3300018769Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002195 (ERX1789526-ERR1719205)EnvironmentalOpen in IMG/M
3300018770Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789454-ERR1719490)EnvironmentalOpen in IMG/M
3300018798Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001604 (ERX1789622-ERR1719156)EnvironmentalOpen in IMG/M
3300018801Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000063 (ERX1789476-ERR1719434)EnvironmentalOpen in IMG/M
3300018816Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001814 (ERX1789388-ERR1719355)EnvironmentalOpen in IMG/M
3300018836Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000807 (ERX1789715-ERR1719504)EnvironmentalOpen in IMG/M
3300018837Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782235-ERR1712073)EnvironmentalOpen in IMG/M
3300018852Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001606 (ERX1809471-ERR1739847)EnvironmentalOpen in IMG/M
3300018854Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000076 (ERX1789602-ERR1719346)EnvironmentalOpen in IMG/M
3300018859Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000012 (ERX1789645-ERR1719429)EnvironmentalOpen in IMG/M
3300018861Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002482 (ERX1789410-ERR1719398)EnvironmentalOpen in IMG/M
3300018872Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_E500000196 (ERX1789513-ERR1719216)EnvironmentalOpen in IMG/M
3300018905Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002775 (ERX1789358-ERR1719472)EnvironmentalOpen in IMG/M
3300018908Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001584 (ERX1789660-ERR1719479)EnvironmentalOpen in IMG/M
3300018929Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_072 - TARA_N000000843 (ERX1782134-ERR1712223)EnvironmentalOpen in IMG/M
3300018930Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001396 (ERX1782254-ERR1712008)EnvironmentalOpen in IMG/M
3300018947Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003102 (ERX1782406-ERR1712029)EnvironmentalOpen in IMG/M
3300018957Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782215-ERR1712088)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018969Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782234-ERR1712179)EnvironmentalOpen in IMG/M
3300018987Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000041 (ERX1789590-ERR1719255)EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018999Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003100 (ERX1782275-ERR1712038)EnvironmentalOpen in IMG/M
3300019011Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_076 - TARA_N000000871 (ERX1782184-ERR1712079)EnvironmentalOpen in IMG/M
3300019016Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000045 (ERX1789509-ERR1719322)EnvironmentalOpen in IMG/M
3300019017Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002781EnvironmentalOpen in IMG/M
3300019020Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002813 (ERX1789673-ERR1719264)EnvironmentalOpen in IMG/M
3300019024Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789427-ERR1719237)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019044Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_038 - TARA_N000000041 (ERX1789478-ERR1719328)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019143Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782306-ERR1712244)EnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300019152Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_150 - TARA_N000002717EnvironmentalOpen in IMG/M
3300021862Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-4 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021883Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S0 C1 B9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021886Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0103951_1056415123300008832MarineMKKYSNLRQMGGEELGHSKGTDFVVAEDLGHLLVGGEELSVLRILEVVLFQVSPKLFDAFSTAGFLLADDVSQFGGELHGFGETGSFRHGDLR*
Ga0103951_1080339713300008832MarineMMRKYCNLRQMGREELGHSKGADFVIAEDLGHFLVGGEVLPVLGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGE
Ga0103502_1018247413300008998MarineMMKKYCNLRQMGREEFGHSKGTDFVIAKDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGLEKKNLGIVIKPKE*
Ga0103502_1028001113300008998MarineMKIYSNLRQMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLANDVSQFGGELHGFGETGSFRHGDLR*
Ga0103502_1028612713300008998MarineMAGAVEVSMISVQLGEMMKKYSNLRQMGGEELGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWFSVKI*
Ga0103706_1004746923300009022Ocean WaterMISIQLVEMMKIYSNLRQMGGEELGHSEGTDFVVAKDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLANDVSQFSGELHGFGESGSFRHGDLRWVFGSV*
Ga0103708_10021530413300009028Ocean WaterMMKKYCNLRQMGREEFGHSKGTDFVIAKDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLANNVSQFSGELHGFGESRSFRHGDLKWVFGSV*
Ga0103842_101518313300009216River WaterMISIQLVEMMKIYSNLRQMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFG*
Ga0103842_101741023300009216River WaterMISIQLVEMMKIYSNLRQMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSRELHGFGESGSFRHGDL*
Ga0103876_105662213300009269Surface Ocean WaterMISIQLVEMMKIYSNLRQMGGEELGHSEGTDFVVAEDLGHLLVRDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLANDVSQFSGELHGFGESGSFRHGDLRWVFG*
Ga0103840_10088613300009316River WaterMISIQLVEMMKIYSNLRQMGGEELGHSKGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTASFLLANDGSKVLAELHGFGKSSSFRHFDFFVGS
Ga0103833_100432013300009333River WaterMKIYSNLRQMGGEELGHSEGTDFVIAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFSTASLFFANNVGEVSAKLHGFGESGSFGHFWMFFGG
Ga0115102_1049468413300009606MarineMKKYSNLRQMGREELGHSKGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTASFLLADNVSQFGGELHGFGETGSFRHGDFFRISF*
Ga0138316_1048827413300010981MarineMAGAVEVSMISVQLGEMMKKYSNLRQMGGEEFGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRGVDG*
Ga0138324_1015663723300010987MarineMAGAVEVSMISVQLGEMMKKYSNLRQMGGEEFGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWFSVKI*
Ga0138324_1064448113300010987MarineMAGAVEVSMISVQLGEMMKKYSNLRQMGGEEFGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVGPKLFDAFSTAGFLLADDVSQFSGELHGFGESGSFRHGDLRGVDG*
Ga0138324_1066101313300010987MarineMAGAVEVSMISVQLGEMMKKYSNLRQMGGEEFGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFSTAGFLLADDVSQVSGELHGFGESGSFRHGDLRWVFGLEKKNLGIVIKPKE*
Ga0193465_10488713300018504MarineMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGETGSFSHGVLR
Ga0193465_10495513300018504MarineMGREELGHSKGADFVVAEDLGHFLVGGEVLPVLGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGETGSFSHGVLR
Ga0193462_10645713300018518MarineMISIQLVEMMKIYSNLRQMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGSV
Ga0193079_101262913300018581MarineMISIQLVEMMKIYSNLRQMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVRQFSGELHGFGESGSFRHG
Ga0193340_101588513300018584MarineMISIQLVEMMKIYSNLRQMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFG
Ga0193141_101328213300018588MarineMAGAVEVSMISVQLGEMMKKYSNLRQMGGEEFGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFSTAGFLLADDVSQFSGELHGFGESGSFRHGDLRGVDG
Ga0193141_101343913300018588MarineMGREELGHSKGADFVVAEDLGHFLVGGEVLPVLGILEVVLFQVSPKLFDAFSTAGFLLADDVSQFSGELHGFGESGSFRHGDLRGVDG
Ga0193447_102018413300018604MarineMISIQLVEMMKIYSNLRQMGGEELGHSKGTDFVVAEDLGHLLVGGEELSVLRILEVVLFQVSPKLFDAFSTAGFLLADDVSQFGGELHGFGETGSFRHGDLR
Ga0193447_102363013300018604MarineMKIYSNLRQMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGSV
Ga0193316_102476213300018611MarineMISIQLVEMMKIYSNLRQMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGLV
Ga0193316_102974213300018611MarineMGREEFGHSKGTDFVIAKDLGHLLVWGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGLV
Ga0193142_106628313300018641MarineMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRGVDG
Ga0193352_105263513300018644MarineMGREELGHSKGTDFVVAEDLGHLLVGGEELSVLRILEVVLFQVSPKLFDAFSTAGFLLADDVSQFGGELHGFGETGS
Ga0192937_103355413300018651MarineMGREEFGHSKGTDFVIAKDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGETGSFRHGDLRWVFG
Ga0192993_103298313300018652MarineMISIQLVEMMKIYSNLRQMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFSTAGFLLADDVSQFSRELHGFGESGSFRHGDLRWVFGS
Ga0192846_103235113300018655MarineMISIQLVEMMKIYSNLRQMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLANDVSQFSGELHGFGESGSFRDGDLRWVFGSV
Ga0192889_105522713300018657MarineMGREEFGHSKGTDFVIAKDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGSV
Ga0193130_103621013300018660MarineMGREELGHSKGADFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGSV
Ga0193159_104647113300018666MarineMKKYCNLRQMGREEFGHSKGTDFVIAKDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGSV
Ga0193007_104471813300018678MarineMGREELGHSKGTDFVVAEDLGHLLVGGEELPVFGILEVVLFQVSPKLFDAFGTAGFLLANDVSQFGGELHGFGETGSFRHGDLR
Ga0192840_104098513300018686MarineMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLANDVSQFSGELHGFGESGSFRHGDLRWVFG
Ga0192840_104743413300018686MarineMGREELGHSKGADFVVAEDLGHLLVGGEELPVFGILEVVLFQVSPKLFDAFGTAGFLLANDVSQFSGELHGFGESGSFRHGDLRWVFG
Ga0192840_105272613300018686MarineMGREEFGHSKGTDFVIAKDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLANDVSQFSGELHGFGESGSFRHGDLRWVFG
Ga0192917_105362013300018690MarineMGREEFGHSKGTDFVIAKDLGHLLVWGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGSV
Ga0193405_104654213300018701MarineMISIQLVEMMKIYSNLRQMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSRELHGFGESGSFRHGDL
Ga0192954_104211713300018704MarineMAGAVEVSMISVQLGEMMKKYSNLRQMGGEELGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFSTAGFLLADDVSQFSGELHGFGESGSFRHGDLRGVDG
Ga0192920_108039013300018708MarineMKIYSNLRQMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFG
Ga0193209_106074113300018709MarineMGREEFGHSKGTDFVIAKDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGLV
Ga0192866_107154613300018720MarineMGREELGHSKGADFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFSTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGLEKKNLGIVIKPKE
Ga0193529_105887313300018731MarineMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLANNVSQFSGELHGFGETGSFRHGDLRWVFG
Ga0193529_106707113300018731MarineMGREEFGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLANNVSQFSGELHGFGETGSFRHGDLRWVFG
Ga0193036_104928613300018733MarineMGGEELGHSEGTDFVVAEDLGHLLVGDEELFVFGILEVVLFQVSPKLFDAFSTAGFLLADDVSQFGGELHGFGETGSFRHGDLR
Ga0193147_106535613300018747MarineMGREELGHSKGADFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFSTAGFLLADDVSQFSGELHGFGESGSFRHGDLRGVDG
Ga0192902_108154913300018752MarineMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGSV
Ga0192902_108344713300018752MarineMGREELGHSKGTDFVVAEDLGHLLVGGEELPVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGSV
Ga0192902_108825113300018752MarineMGGEELGHSKGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGSV
Ga0192902_109414913300018752MarineMGREELGHSKGADFVVAEDLGHLLVGGEELPVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGSV
Ga0193478_106063313300018769MarineMGREELGHSKGADFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRGVDG
Ga0193478_106307113300018769MarineMIGIQCGEMMKKYSNLRQMGGEELGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTASFLLADNVSQFGGELHGFGETGSFRHGDLRWVFGLEKKNLGIVIKPKE
Ga0193478_106696113300018769MarineMVAAVEVSMISIQLGEMMKKYSNLRQMGGEEFGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRGVDG
Ga0193478_106902213300018769MarineMGGEELGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFSTAGFLLADDVSQFSGELHGFGESGSFRHGDLRGVDG
Ga0193530_108856913300018770MarineMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFSTAGFLLADDVSQFSGELHGFGESGSFRHGDLRGVDG
Ga0193283_107105713300018798MarineMISIQLVEMMKIYSNLRQMGGEELGHSKGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGLV
Ga0192824_110347513300018801MarineMISIQLVEMMKIYSNLRQMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFGHGDLRWVFGSV
Ga0193350_107655313300018816MarineMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGETGSFRHGDLR
Ga0192870_109128013300018836MarineMISVQLGEMLKKYSNLRQMGGEELGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVGPKLFDAFSTAGFLLADDVSQFSGELHGFGESGSFRHGDLRGVDG
Ga0192927_102374613300018837MarineMISIQLVEMMKIYSNLRQMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLANDVSQFSGELHGFGETGSFRHGDLRWVFG
Ga0193284_105249413300018852MarineMGREELGHSKGADFVVAEDLGHFLVGGEVLPVLGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGLV
Ga0193284_106537813300018852MarineMMKNLRQMGREEFGHSKGTDFVIAKDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGLV
Ga0193284_108066813300018852MarineMGGEELGHSKGTDFVIAEDLGHLLVGGEELSVLRILEVVLFQVSPKLFDAFSTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGLV
Ga0193214_109024713300018854MarineMISIQLVEMMKIYSNLRQMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFSTAGFLLANNVGQFSGELHGFGETLSFRHGDLRWVFG
Ga0193199_110723113300018859MarineMISIQLVEMMKIYSNLRQMGGEELGHSEGTDFVIAKDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDL
Ga0193199_112142313300018859MarineMGREEFGHSKGTDFVIAKDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDL
Ga0193072_109640413300018861MarineMAGAVEVSMISVQLGEMMKKYSNLRQMGGEEFGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRGVDG
Ga0193162_108998113300018872MarineMGREELGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGSV
Ga0193162_110308613300018872MarineMAGAVEVSMISVQLGEMMKKYSNLRQMGGEEFGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGSV
Ga0193028_110977313300018905MarineMAGAVEVSMISVQLGEMLKKYSNLRQMGREELGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRGVDG
Ga0193279_112408723300018908MarineMGREELGHSKGADFVVAEDLGHFLVGGEVLPVLGILEVVLFQVSPKLFDAFGTAGFLLANDVSQFGGELHGFGETGS
Ga0193279_112408823300018908MarineMGGEELGHSKGTDFVVAEDLGHLLVGGEELSVLRILEVVLFQVSPKLFDAFSTAGFLLADDVSQFGGELHGFGETGS
Ga0192921_1017747813300018929MarineMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFG
Ga0192955_1014900813300018930MarineMVAAVEVSMISIQLGEMMKKYSNLRQMGGEELGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFSTAGFLLADDVSQFSGELHGFGESGSFRHGDLRGVDG
Ga0192955_1014901113300018930MarineMVAAVEVSMISIQLGEMMKKYCNLRQMGGEEFGHSKGTDFVIAKDLGHLLVWGEELLVCGILEVVLFQVSPKLFDAFSTAGFLLADDVSQFSGELHGFGESGSFRHGDLRGVDG
Ga0193066_1016538613300018947MarineMGREELGHSKGADFVVAEDLGHLLVGGEELSVLRILEVVLFQVSPKLFDAFSTAGFLLADDVSQFSGELHGFGESGIL
Ga0193066_1022402313300018947MarineMGREEFGHSKGTDFVIAKDLGHLLVWGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLANDVSQFGGELHGFGETGSFRHGDLRWVFG
Ga0193528_1025532013300018957MarineMVAVEVSMIGIHYGEMMKKYSNLRQMGGEELGHSKGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGSV
Ga0193528_1027584513300018957MarineMAGAVEVSMISVQLGEMMKKYSNLRQMGGEEFGHSKGTDFVVAEDLGHLLVGGEELSVLRILEVVLFQVSPKLFDAFSTAGFLLADDVSQFGGELHGFGETGSFRHGDLRWVFG
Ga0193528_1031635713300018957MarineMGREELGHSKGTDFVVAEDLGHLLVGGEELSVLRILEVVLFQVSPKLFDAFSTAGFLLADDVSQFGGELHGFGETGSFRHGDLRWVFG
Ga0193528_1031639513300018957MarineMGREELSHSKGTDFVGAEDLGHLLVGGEELPVLRILEVVLFQVSPKLFDAFSTAGFLLADDVSQFGGELHGFGETGSFRHGDLRWVFG
Ga0193531_1027955113300018961MarineMVAAVEVSMISIQLGEMMKKYSNLRQMGGEELGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRGVDG
Ga0193143_1018254113300018969MarineMGGEELGHSEGSDFVIAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLR
Ga0193143_1021279713300018969MarineMAGAVEVSMISVQLGEMMKKYSNLRQMGGEEFGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLR
Ga0193188_1007746113300018987MarineMISIQLVEMMKIYSNLRQMGGEELGHSKGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDL
Ga0193188_1007771913300018987MarineMGREEFGHSKGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDL
Ga0193275_1016495323300018988MarineMCGEEFGHSKGTDFVIAEDLGHLLVGGEELSVLRILEVVLFQVSPKLFDAFSTAGFLLADDVSQFGGELHGFGETGSFRHGDLRWVFG
Ga0193030_1025836613300018989MarineMAGAVEVSMISVQLGEMMKKYSNLRQMGGEEFGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFNAFSTAGFLLADDVSQFSRELHGFGESGSFRHGDLRWFSVKI
Ga0193514_1025248313300018999MarineMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGLV
Ga0192926_1004486113300019011MarineMMKKYCNLRQMGREEFGHSKGTDFVIAKDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGETGSFRHGDLRWVFG
Ga0192926_1004493413300019011MarineMISIQLVEMMKIYSNLRQMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGETGSFRHGDLRWVFG
Ga0193094_1024779613300019016MarineMISIQLVEMMKIYSNLRQMGGEELGHSEGTDFVIAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFG
Ga0193569_1037186013300019017MarineMAGAVEVSMISVQLGEMMKKYSNLRQMGGEEFGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFSTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGLEKKNLGIVIKPKE
Ga0193538_1022035923300019020MarineMVAAVEVSMISIQLGEMMKKYSNLRQMGGEELGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWFSVKI
Ga0193538_1022038323300019020MarineMVAAVEVSMISIQLGEMMKKYCNLRQMGGEEFGHSKGTDFVVAKDLGHLLVWGEELLVCGILEVVLFQVSPKLFDAFSTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWFSVKI
Ga0193538_1023295023300019020MarineMAGAVEVSMISVQLGEMLKKYSNLRQMGREELGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFSTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWFSVKI
Ga0193538_1025761623300019020MarineMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWFSVKI
Ga0193535_1024664813300019024MarineMAGAVEVSMISVQLGEMMKKYSNLRQMGGEEFGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGLEKKNLGIVIKPKE
Ga0192945_1026428423300019036MarineMVAAVEVSMISIQLGEMMKKYSNLRQMGGEEFGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFSTAGFLLADDVSQFSGELHGFGESGSFRHGDLRGVDG
Ga0193189_1011940213300019044MarineMISIQLVEMMKIYSNLRQMGGEELGHSKGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLANDVSQFSGELHGFGESGSFRHGDLRWVFG
Ga0192946_105083313300019103MarineMAGAVEVSMISVQLGEMMKKYSNLRQMGGEEFGHSKGTDFVIAKDLGHLLVWGEELLVCGILEVVLFQVSPKLFDAFSTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWFSVKI
Ga0192856_104889113300019143MarineMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFGGELHGFGETGSFRHGDLR
Ga0194244_1010990113300019150MarineMISIQLVEMMKIYSNLRQMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLR
Ga0193564_1018414923300019152MarineMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGETGSFRHGDLRWVFG
Ga0193564_1018892923300019152MarineMIGIQCGEMMKKYSNLRQMGGEELGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGETGSFRHGDLRWVFG
Ga0193564_1022978723300019152MarineMKKYSNLRQMGGEELGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGETGSFRHGDLRWVFG
Ga0193564_1023035023300019152MarineMIGIHYGEMMKKYSNLRQMGGEELGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGETGSFRHGDLRWVFG
Ga0063112_10223913300021862MarineMISIQLVEMMKIYSNLRQMGGEELGHSKGTDFVIAEDLGHLLVGNEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGSV
Ga0063126_101035113300021883MarineMISIQLVEMMKIYSNLRQMGGEELGHSEGTDFVVAEDLGHLLVGDEELLVFGILEVVLFQVSPKLFDAFGTAGFLLADDVSQFSGELHGFGESGSFRHGDLRWVFGSVLKKKNLGIGVEPIE
Ga0063114_101108913300021886MarineMAGAVEVSMISVQLGEMMKKYSNLRQMGGEEFGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVGPKLFDAFSTAGFLLANDVSQFSGELHGFGESGSFRHGDLRGVDG
Ga0307383_1067639013300031739MarineMISVQLGEMLKKYSNLRQMGGEELGHSKGTDFVVAEDLGHLLVGGEELSVFGILEVVLFQVGPKLFDAFSTAGFLLANDVSQFSGELHGFGESGSFRHGDLRGVDG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.