NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F092375

Metagenome / Metatranscriptome Family F092375

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F092375
Family Type Metagenome / Metatranscriptome
Number of Sequences 107
Average Sequence Length 46 residues
Representative Sequence MNVHMIGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTEMLG
Number of Associated Samples 85
Number of Associated Scaffolds 107

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 81.31 %
% of genes near scaffold ends (potentially truncated) 19.63 %
% of genes from short scaffolds (< 2000 bps) 87.85 %
Associated GOLD sequencing projects 74
AlphaFold2 3D model prediction Yes
3D model pTM-score0.31

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.131 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(8.411 % of family members)
Environment Ontology (ENVO) Unclassified
(59.813 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(70.093 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 22.97%    β-sheet: 0.00%    Coil/Unstructured: 77.03%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.31
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 107 Family Scaffolds
PF01176eIF-1a 49.53
PF00313CSD 18.69
PF04820Trp_halogenase 6.54
PF04226Transgly_assoc 1.87
PF01434Peptidase_M41 0.93
PF01839FG-GAP 0.93
PF02604PhdYeFM_antitox 0.93
PF10431ClpB_D2-small 0.93
PF09694Gcw_chp 0.93
PF14559TPR_19 0.93
PF03129HGTP_anticodon 0.93
PF012572Fe-2S_thioredx 0.93
PF12915DUF3833 0.93

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 107 Family Scaffolds
COG0361Translation initiation factor IF-1Translation, ribosomal structure and biogenesis [J] 49.53
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 1.87
COG0124Histidyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.93
COG0423Glycyl-tRNA synthetase, class IITranslation, ribosomal structure and biogenesis [J] 0.93
COG0441Threonyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.93
COG0442Prolyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.93
COG0465ATP-dependent Zn proteasesPosttranslational modification, protein turnover, chaperones [O] 0.93
COG1905NADH:ubiquinone oxidoreductase 24 kD subunit (chain E)Energy production and conversion [C] 0.93
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 0.93
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 0.93

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.13 %
UnclassifiedrootN/A1.87 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459003|FZ032L002IF4YEAll Organisms → cellular organisms → Bacteria540Open in IMG/M
2199352024|deeps__Contig_162722All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300001989|JGI24739J22299_10175109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SCG-1632Open in IMG/M
3300002568|C688J35102_120960134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas3192Open in IMG/M
3300005329|Ga0070683_100332360All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1447Open in IMG/M
3300005331|Ga0070670_100339793All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1318Open in IMG/M
3300005334|Ga0068869_100564678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria958Open in IMG/M
3300005338|Ga0068868_101588733All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae614Open in IMG/M
3300005339|Ga0070660_101419311All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300005343|Ga0070687_100979137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae612Open in IMG/M
3300005355|Ga0070671_100334753All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1291Open in IMG/M
3300005356|Ga0070674_102047703All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300005364|Ga0070673_101719763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae594Open in IMG/M
3300005457|Ga0070662_101371328All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas609Open in IMG/M
3300005459|Ga0068867_100948687All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria777Open in IMG/M
3300005535|Ga0070684_100334622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales1392Open in IMG/M
3300005535|Ga0070684_100754115All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria909Open in IMG/M
3300005539|Ga0068853_101896634Not Available578Open in IMG/M
3300005544|Ga0070686_100000186All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae43742Open in IMG/M
3300005544|Ga0070686_101834868All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300005548|Ga0070665_100000334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas72297Open in IMG/M
3300005564|Ga0070664_101140726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae735Open in IMG/M
3300005578|Ga0068854_100365581All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1185Open in IMG/M
3300005587|Ga0066654_10240590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria952Open in IMG/M
3300005842|Ga0068858_101082614All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria787Open in IMG/M
3300006177|Ga0075362_10698433All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae529Open in IMG/M
3300006237|Ga0097621_101809729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae582Open in IMG/M
3300006854|Ga0075425_102888544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae527Open in IMG/M
3300006871|Ga0075434_100303290All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1617Open in IMG/M
3300009093|Ga0105240_11446245All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria722Open in IMG/M
3300009098|Ga0105245_11467507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae733Open in IMG/M
3300009098|Ga0105245_12108242All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium617Open in IMG/M
3300009098|Ga0105245_12209871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas604Open in IMG/M
3300009174|Ga0105241_11570858All Organisms → cellular organisms → Bacteria → Terrabacteria group635Open in IMG/M
3300009545|Ga0105237_11495900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae682Open in IMG/M
3300009551|Ga0105238_11508810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Novosphingobium701Open in IMG/M
3300009551|Ga0105238_12277038All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SCG-1577Open in IMG/M
3300010397|Ga0134124_12133467All Organisms → cellular organisms → Bacteria599Open in IMG/M
3300010397|Ga0134124_13032392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SCG-1513Open in IMG/M
3300010400|Ga0134122_10335395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1311Open in IMG/M
3300010401|Ga0134121_10584484All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1042Open in IMG/M
3300011241|Ga0137476_106803All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae678Open in IMG/M
3300011244|Ga0137483_101546All Organisms → cellular organisms → Bacteria → Proteobacteria2775Open in IMG/M
3300012212|Ga0150985_103916420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae938Open in IMG/M
3300012212|Ga0150985_114153579All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae717Open in IMG/M
3300012212|Ga0150985_115455613All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SCG-1562Open in IMG/M
3300012212|Ga0150985_116804042All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae747Open in IMG/M
3300012212|Ga0150985_122739256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae740Open in IMG/M
3300012469|Ga0150984_100078174All Organisms → cellular organisms → Bacteria815Open in IMG/M
3300012469|Ga0150984_102783843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae771Open in IMG/M
3300012469|Ga0150984_103948801All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae574Open in IMG/M
3300012469|Ga0150984_111355977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae656Open in IMG/M
3300012469|Ga0150984_114703103All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae765Open in IMG/M
3300012469|Ga0150984_118477999All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300012469|Ga0150984_120924541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1247Open in IMG/M
3300012924|Ga0137413_10413376All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300012944|Ga0137410_11991269All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300012955|Ga0164298_11242887Not Available567Open in IMG/M
3300013100|Ga0157373_10667960All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae760Open in IMG/M
3300013296|Ga0157374_11238971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae768Open in IMG/M
3300013297|Ga0157378_11792874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae662Open in IMG/M
3300013308|Ga0157375_12602702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae604Open in IMG/M
3300015064|Ga0167641_106626All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1474Open in IMG/M
3300015085|Ga0167632_1012275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1203Open in IMG/M
3300015161|Ga0167623_1015423All Organisms → cellular organisms → Bacteria → Proteobacteria2097Open in IMG/M
3300015171|Ga0167648_1104068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium564Open in IMG/M
3300017792|Ga0163161_10680013All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas855Open in IMG/M
3300018422|Ga0190265_10769791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1085Open in IMG/M
3300018431|Ga0066655_10566041All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales761Open in IMG/M
3300018432|Ga0190275_10000592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae30469Open in IMG/M
3300018469|Ga0190270_12237678All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae607Open in IMG/M
3300018476|Ga0190274_10327544All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae1442Open in IMG/M
3300019263|Ga0184647_1278407All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300019269|Ga0184644_1709543All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300019279|Ga0184642_1591376All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae850Open in IMG/M
3300020034|Ga0193753_10243443All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae802Open in IMG/M
3300020059|Ga0193745_1000002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas637768Open in IMG/M
3300020070|Ga0206356_10809954All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales1352Open in IMG/M
3300021384|Ga0213876_10025229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae3137Open in IMG/M
3300021953|Ga0213880_10002595All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae3028Open in IMG/M
3300025911|Ga0207654_11179400All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300025920|Ga0207649_10544819All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae887Open in IMG/M
3300025924|Ga0207694_10062831All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae2892Open in IMG/M
3300025927|Ga0207687_10900304All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae757Open in IMG/M
3300025931|Ga0207644_10556580All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SCG-1950Open in IMG/M
3300025931|Ga0207644_10907231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae739Open in IMG/M
3300025935|Ga0207709_11262555All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300025944|Ga0207661_10780010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SCG-1880Open in IMG/M
3300025945|Ga0207679_12146904All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae507Open in IMG/M
3300025949|Ga0207667_12051407All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300025981|Ga0207640_10857410All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales791Open in IMG/M
3300025981|Ga0207640_11906077All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300025986|Ga0207658_11450462All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales628Open in IMG/M
3300026023|Ga0207677_11901011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae553Open in IMG/M
3300026035|Ga0207703_12285926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SCG-1516Open in IMG/M
3300026088|Ga0207641_10023444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas5085Open in IMG/M
3300026089|Ga0207648_10970256All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300028379|Ga0268266_10000103All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas179736Open in IMG/M
3300028790|Ga0307283_10137616All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas666Open in IMG/M
3300030988|Ga0308183_1032134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae968Open in IMG/M
3300031824|Ga0307413_10078746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae2104Open in IMG/M
3300031824|Ga0307413_10456345All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300031824|Ga0307413_10675684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria855Open in IMG/M
3300032004|Ga0307414_10254424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales1462Open in IMG/M
3300032004|Ga0307414_10629259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales965Open in IMG/M
3300032004|Ga0307414_11225518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SCG-1695Open in IMG/M
3300032126|Ga0307415_101181741All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → unclassified Sphingobium → Sphingobium sp. SCG-1720Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.41%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere7.48%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere6.54%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere6.54%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere6.54%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil5.61%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere5.61%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere4.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.67%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere4.67%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.74%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.74%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.80%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.80%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.87%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.87%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.93%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.93%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.93%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.93%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.93%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.93%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.93%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.93%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459003Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cmEnvironmentalOpen in IMG/M
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300001989Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5Host-AssociatedOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006177Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011241Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 11 - S13.2.50.a - transect 2, age 50 years, surface depth).EnvironmentalOpen in IMG/M
3300011244Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 18 - S13.2.60.3.a - transect 2, repeat 3, age 113 years, surface depth)EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015064Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7B, Adjacent to main proglacial river, mid transect (Watson river))EnvironmentalOpen in IMG/M
3300015085Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake)EnvironmentalOpen in IMG/M
3300015161Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G1B, Ice margin)EnvironmentalOpen in IMG/M
3300015171Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3a, vegetated patch on medial moraine)EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019269Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300020059Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021953Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025924Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028790Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122EnvironmentalOpen in IMG/M
3300030988Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031824Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2Host-AssociatedOpen in IMG/M
3300032004Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3Host-AssociatedOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E4A_068889402170459003Grass SoilMKLHNIGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTEMLG
deeps_029983602199352024SoilMNLQTIGSTRPKLYPPKALLSMGPMERRSPTLSAFELRLIVTEVIG
JGI24739J22299_1017510923300001989Corn RhizosphereMKLSNPGSKRPKLFPPKALLADGPSERRSPTLSGFELRNVVTEMLG*
C688J35102_12096013443300002568SoilMNIQILGSKRPKLWPPKALLSGAPIEARFPTLSGTELRRIVTEVLG*
Ga0070683_10033236023300005329Corn RhizosphereMNVQNIGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTELLG*
Ga0070670_10033979353300005331Switchgrass RhizosphereMNVQMTGSKRPKLYPPKALLAAGPIERRSPTLSGLELRHIVTEM
Ga0068869_10056467833300005334Miscanthus RhizosphereMNVHMTGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTEMLG*
Ga0068868_10158873323300005338Miscanthus RhizosphereMNVQNIGSKRPKLYPPKALLAAEPIERRSPTLSGFELRHIVTEMLG*
Ga0070660_10141931123300005339Corn RhizosphereMNVHTIGSKRPKLYPPKALLAGGPGERRSPTLSGFELRNIVTEMLG*
Ga0070687_10097913723300005343Switchgrass RhizosphereMNLQTMGPKRPKLYPPKALLAAGPIERRSPTLSGFELRNIVTEMLG*
Ga0070671_10033475333300005355Switchgrass RhizosphereMNVHMTGSKRPKLYPPKALLAAGPIGRRSPTLSGFELRNIVTEMLG*
Ga0070674_10204770323300005356Miscanthus RhizosphereMNVQMTGSKRPKLYPPKALLAAGPIERRSPTLSGLELRHIVTEMLG*
Ga0070673_10171976323300005364Switchgrass RhizosphereMNVQMNGSKRPKLYPPKALLAAGPMPDRSPTLSGFELRKIVTEMLG*
Ga0070662_10137132823300005457Corn RhizosphereMNIEMNGSKRPKLYPPKALLAAGPIERRSPTLSGFELRNIVTEMLG*
Ga0068867_10094868733300005459Miscanthus RhizosphereMNVHTIGSKRPKLYLPKALLAAGPIERRSPTLSGLELRHIVTEMLG
Ga0070684_10033462253300005535Corn RhizosphereMNVEHQGPKRPRLYLPKALLAAGPSQRRSPTLSVLELRAAVTEMVG*
Ga0070684_10075411523300005535Corn RhizosphereMNTGNPGPKRPKLYPPKALLAAGPTERRSPILSSFELRNIVTELLG*
Ga0068853_10189663413300005539Corn RhizosphereMKLSNPGSKRPKLYPPKALLAAGPSERRSPTLSGFELRNVVTEMLG*
Ga0070686_100000186153300005544Switchgrass RhizosphereMNVQNIGSKRPKLYPPKALLAAGPMPDRSPTLSGFELRKIVTEMLG*
Ga0070686_10183486813300005544Switchgrass RhizosphereMNVHMTGSKRPKLYPPKALLAAGPIERRSPTLSGFELRNIVTEMLG*
Ga0070665_100000334713300005548Switchgrass RhizosphereMNVHMIGSKRPKLYPPKALLAAGPIERRSPTLSGFELRNIVTEMLG*
Ga0070664_10114072623300005564Corn RhizosphereMNVHTIGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTELLG*
Ga0068854_10036558133300005578Corn RhizosphereMNIQTNGSMRPKLYPPKALLAAGTTERRPPILSGFELRKIVTEMLG*
Ga0066654_1024059033300005587SoilMNGSKRPKLYPPKALLAAGTIERRPPILSGFELRKIVTETLG*
Ga0068858_10108261433300005842Switchgrass RhizosphereMNVHMTGSKRPKLYPPKALLAAGPGERRSPTLSGFELRHIVTEMLG*
Ga0075362_1069843323300006177Populus EndosphereMNVQMTGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTEMLG*
Ga0097621_10180972923300006237Miscanthus RhizosphereMNLQNEGSKRPKLYPPKALLAAGPIERRSPTLSGLELRHIVTEMLG*
Ga0075425_10288854423300006854Populus RhizosphereMKLPNIGPQRPKLYPPKALLAAGPIERRSPTLSGFELRLIVTEMLG*
Ga0075434_10030329033300006871Populus RhizosphereMKLANIGPQRPKLYPPKALLAAGPIERRSPTLSGFELRLIVTEMLG*
Ga0105240_1144624523300009093Corn RhizosphereMNTGNPGPQRPKLYPPKALLAAGPTERRSPILSSFELRNIVTELLG*
Ga0105245_1146750723300009098Miscanthus RhizosphereMNVHTDGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTEMLG*
Ga0105245_1210824233300009098Miscanthus RhizosphereMNVHTIGSKRPKLYLPKALLAAGPIERRSPTLSGL
Ga0105245_1220987113300009098Miscanthus RhizosphereKRPKLYPPKALLAAEPIERRSPTLSGFELRHIVTEMLG*
Ga0105241_1157085823300009174Corn RhizosphereMNVHTIGSKRPKLYPPKALLAAGPIERRSPTLSGLELRHIVTEMLG*
Ga0105237_1149590013300009545Corn RhizosphereMNVHTIGSKRPKLYLPKALLAAGPIERRSPTLSGLELRHIVTEML
Ga0105238_1150881033300009551Corn RhizosphereMNVHTIGSKRPKLYLPKALLAAGPIERRSPTLSGFELRHIVTEMLG*
Ga0105238_1227703813300009551Corn RhizosphereMNVNYVGSKRPKLYPPKALLAVGPSQRRSPTLSSLELRNIVTEMLG*
Ga0134124_1213346713300010397Terrestrial SoilMNINMTGPQRPKLYPPKALLAAGPERRSPTLSGLELRKIVTELLG*
Ga0134124_1303239213300010397Terrestrial SoilRNEMNVQMNGSKRPKLYPPKALLAAGPGERRSPTLSGPELRHIVTEMLG*
Ga0134122_1033539533300010400Terrestrial SoilMPGSKRPKLYPPKALLGAGPIERRSPTLSGFELRNIVTEMLG*
Ga0134121_1058448433300010401Terrestrial SoilMTGSKRPKLYPPKALLAAGPIGRRSPTLSGFELRNIVTE
Ga0137476_10680323300011241Glacier Forefield SoilMNLQNIGSTRPKLYPPKALLSMGPMERRSPNLSDAELRYIVIQVIG*
Ga0137483_10154623300011244Glacier Forefield SoilMNLQISGSTRPKLYPPKALLSIGPGERRSPILSGTELRRVVTEVIG*
Ga0150985_10391642023300012212Avena Fatua RhizosphereMNISTIGSKRPKLYPPKALLAAGPGERRSPTLSGFELRHIVTEMLG*
Ga0150985_11415357933300012212Avena Fatua RhizosphereMNVQMTGSKRPKLSPPKALLAAGPIERRSPTLSGFELRNIVTEMLG*
Ga0150985_11545561323300012212Avena Fatua RhizosphereMNISTIGSKRPKLYPPKALLAAGPGERRSPTLSSFELRMIVTELLG*
Ga0150985_11680404213300012212Avena Fatua RhizosphereMNVQTTGSKRPKLYPPKALLAAGPIERRSPTLSGLEL
Ga0150985_12273925623300012212Avena Fatua RhizosphereMIGSKRPKLYPPKALLAAGAIERRSPTLSGIELRHIVTEMLG*
Ga0150984_10007817413300012469Avena Fatua RhizosphereMNVHNIGSKRPKLYPPKALLAAGPSERRSPTLSGFELRNIVTEMLG*
Ga0150984_10278384313300012469Avena Fatua RhizosphereMNVQMTGSKRPKLYPPKALLAAGPIERRSPTLSGLELRHI
Ga0150984_10394880123300012469Avena Fatua RhizosphereMKLPNIGSTRPKLYPPKALLAAGPGERRSPTLSGFELRNIVTEMLG*
Ga0150984_11135597733300012469Avena Fatua RhizosphereMNISTIGSKRPKLYPPKALLAAGPGERRSPTLSGFELRHIVTEMLG
Ga0150984_11470310313300012469Avena Fatua RhizosphereMNVQTTGSKRPKLYPPKALLAAGPIERRSPTLSGLELRHIVTE
Ga0150984_11847799923300012469Avena Fatua RhizosphereMTGSKRPKLSPPKALLAAGPIERRSPTLSGLELRHIVTEMLG*
Ga0150984_12092454133300012469Avena Fatua RhizosphereMIGSKRPKLYPPKALLAAGGIERRSPTLSGIELRHIVTEMLG*
Ga0137413_1041337633300012924Vadose Zone SoilMNVHNTGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTEMLG*
Ga0137410_1199126923300012944Vadose Zone SoilMTGSKRPKLSPPKALLAAGPIERRSPTLSGFELRNIVTEMLG*
Ga0164298_1124288723300012955SoilMNVHTIGSKRPKLYLPKALLAAGPIERRSPTLAGFELRHIVTEMLG*
Ga0157373_1066796023300013100Corn RhizosphereMNIQTNGSMRPKLYPPKALLAAGTIERRPPILSGFELRKIVTEMLG*
Ga0157374_1123897123300013296Miscanthus RhizosphereMNVHTIGSKRPKLYLPKALLAAGPIERRSPTLSGLELRHIVTEMLG*
Ga0157378_1179287423300013297Miscanthus RhizosphereMNVHTDGSKRPKLYPPKALLAAEPIERRSPTLSGFELRHIVTEMLG*
Ga0157375_1260270223300013308Miscanthus RhizosphereMGSTRPKLWPPKALLASGPGDRRSPTLSGTELRRIVTEVLG*
Ga0167641_10662633300015064Glacier Forefield SoilMNTQIMGSTRPKLWPPKALQASGPGDRRSPTLSGTELRRIVTEVLG*
Ga0167632_101227533300015085Glacier Forefield SoilMNTQMTGSTRPKLYPPKALLSIGPIERRSPILSGTELRRIVTEVIG*
Ga0167623_101542343300015161Glacier Forefield SoilMNLQIIGSTRPKLYPPKALLSMGPMERRSPTLSGPELRHIVTQVIG*
Ga0167648_110406833300015171Glacier Forefield SoilMNLQTIGSTRPKLYPPKALLSMGPMERRSPTLSAFELRLIVTEVIG*
Ga0163161_1068001313300017792Switchgrass RhizosphereMNIHTDGSKRPKLYPPKALLAAGPGERRSPTLSGFELRHIVTEMLG
Ga0190265_1076979113300018422SoilMNLQITGSKRPKLHLPKALLSSGSGDRRSPLLSGTELRRIVTQVIG
Ga0066655_1056604123300018431Grasslands SoilMNTNMTGSKRPKLYLPKALLAAGMSERRAPILSRPELRTIVIELLG
Ga0190275_1000059293300018432SoilMNLLTIGSTRPKLYPPKALLSMGPTERRSPNLSGTELRRIVTQVIG
Ga0190270_1223767823300018469SoilMNVHIAGSKRPKLYPPKALLACGPTERRSPTLSGFELRHIVTEMLG
Ga0190274_1032754423300018476SoilMNVHITGSKRPKLYPPKALLACGPIERRSPTLSGFELRHIVTEMLG
Ga0184647_127840713300019263Groundwater SedimentMNIHMTGSKRPKLYPPKALLAAGPIERRSPTLSGFELRNIVTEMLG
Ga0184644_170954333300019269Groundwater SedimentMNVHMTGSKRPKLYPPKALLAAGPIERRSPTLSGFELRNIVTEMLG
Ga0184642_159137633300019279Groundwater SedimentMNVHMTGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTEMLG
Ga0193753_1024344313300020034SoilMNVHMIGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTEMLG
Ga0193745_10000022503300020059SoilMNTQIMGSTRPKLWPPKALLASGPGDRRSPTLSGTELRRIVTEVLG
Ga0206356_1080995433300020070Corn, Switchgrass And Miscanthus RhizosphereMNTGNPGPQRPKLYPPKALLAAGPTERRSPILSSFELRNIVTELLG
Ga0213876_1002522953300021384Plant RootsMNVEHQGPKRPRLYLPKALLAAGPAPCRSPTLSTLELRAAVTEMVG
Ga0213880_1000259513300021953Exposed RockMNIGHPGPKRPKLYPPKALLAAGPSERRSPILSSFELRNIVTELLG
Ga0207654_1117940033300025911Corn RhizosphereMNTGNPGPKRPKLYPPKALLAAGPTERRSPILSSFELRNIVTELLG
Ga0207649_1054481913300025920Corn RhizosphereMNVQTNGSKRPKLFLPKALLAAGPSDRRSPTLSGFELRNIVTEMLG
Ga0207694_1006283133300025924Corn RhizosphereMNTGNPGPQRPKLYPPKALLAAGPTERRSPILSSFELRNIVTESLG
Ga0207687_1090030423300025927Miscanthus RhizosphereMNVHTDGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTEMLG
Ga0207644_1055658013300025931Switchgrass RhizosphereSKRPKLYPPKALLAAGPGERRSPTLSGFELRHIVTEMLG
Ga0207644_1090723113300025931Switchgrass RhizosphereMNVHMTGSKRPKLYPPKALLAAGPGERRSPTLSGFELRHIVTEMLG
Ga0207709_1126255513300025935Miscanthus RhizosphereMNVQNIGSKRPKLYPPKALLAAGPMPDRSPTLSGFELRKIVTEMLG
Ga0207661_1078001013300025944Corn RhizosphereQITRRGVPPRTEMNVQNIGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTELLG
Ga0207679_1214690423300025945Corn RhizosphereMNVHTIGSKRPKLYPPKALLAAGPIERRSPTLSGFELRHIVTELLG
Ga0207667_1205140723300025949Corn RhizosphereMNVHTIGSKRPKLYLPKALLAAGPIERRSPTLSGLE
Ga0207640_1085741023300025981Corn RhizosphereMNIQTNGSMRPKLYPPKALLAAGTTERRPPILSGFELRKIVTEMLG
Ga0207640_1190607713300025981Corn RhizosphereMNTQIIGSTRPKLYPPKALLSIWPEQRRSPLLSGTELR
Ga0207658_1145046223300025986Switchgrass RhizosphereMNVHTIGSKRPKLYPPKALLAAEPIERRSPTLSGFELRHIVTEMLG
Ga0207677_1190101123300026023Miscanthus RhizosphereMNVQNIGSKRPKLYPPKALLAAEPIERRSPTLSGFELRHIVTEMLG
Ga0207703_1228592623300026035Switchgrass RhizosphereMNVHTIGSKRPKLYLPKALLAAGPIERRSPTLSGFELRHIVTEMLG
Ga0207641_1002344453300026088Switchgrass RhizosphereMNVHMTGSKRPKLYPPKALLAAGPIGRRSPTLSGFELRNIVTEMLG
Ga0207648_1097025623300026089Miscanthus RhizosphereMNVQNIGSKRPKLYPPKALLAAGPIERRSPTLSGLELRHIVTEMLG
Ga0268266_10000103443300028379Switchgrass RhizosphereMNVHMIGSKRPKLYPPKALLAAGPIERRSPTLSGFELRNIVTEMLG
Ga0307283_1013761633300028790SoilPPRIKMNVHSEGSKRPKLYPPKALLAAGPGERRSPTLSGFELRHIVTEMLG
Ga0308183_103213433300030988SoilMNVHSEGSKRPKLYPPKALLAAGPGERRSPTLSGFELRHIVTEMLG
Ga0307413_1007874643300031824RhizosphereMNIETIGSTRPKLHLPKALLSDGSGERRAPTLSSFELRRIVAELLG
Ga0307413_1045634513300031824RhizosphereMKRRRFPPESEMNIETIGSTRPKLYLPKALLSERSGERRVPTLSSFELKRIVAELLG
Ga0307413_1067568433300031824RhizosphereMMRRIFPPESEMNIETIGSARPKLYLPKALLSERSSESRLATLSSFELRRIVAELLG
Ga0307414_1025442453300032004RhizosphereMKRRRFPPENEMNIETIGSTRPKLFLPKALLSERPSERRVPTLSSFELRRIVAELLG
Ga0307414_1062925933300032004RhizosphereMKRRKIPPESEMNIETIGSTRPKLHLPKALLSDGSGERRAPTLSSFELRRIVAELLG
Ga0307414_1122551823300032004RhizosphereRRRSPPESKMNIETIGSTRPKLYLPKALLSERSGERRVPTLSSFELKRIVAELLG
Ga0307415_10118174113300032126RhizospherePPESKMNIETIGSTRPKLYLPKALLSERSGERRVPTLSSFELKRIVAELLG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.