NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F101186

Metagenome Family F101186

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F101186
Family Type Metagenome
Number of Sequences 102
Average Sequence Length 44 residues
Representative Sequence MLSENQRKLFADFHKSVEAEGILDEKTSHLIKVAAAMAFGCYP
Number of Associated Samples 73
Number of Associated Scaffolds 102

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 87.25 %
% of genes near scaffold ends (potentially truncated) 17.65 %
% of genes from short scaffolds (< 2000 bps) 73.53 %
Associated GOLD sequencing projects 62
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.353 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment
(27.451 % of family members)
Environment Ontology (ENVO) Unclassified
(41.176 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Sediment (saline)
(35.294 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 72.09%    β-sheet: 0.00%    Coil/Unstructured: 27.91%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 102 Family Scaffolds
PF01022HTH_5 3.92
PF00583Acetyltransf_1 2.94
PF01361Tautomerase 2.94
PF00582Usp 1.96
PF05016ParE_toxin 1.96
PF01546Peptidase_M20 1.96
PF00441Acyl-CoA_dh_1 1.96
PF01370Epimerase 1.96
PF01925TauE 0.98
PF00072Response_reg 0.98
PF00861Ribosomal_L18p 0.98
PF10543ORF6N 0.98
PF02635DrsE 0.98
PF13847Methyltransf_31 0.98
PF13635DUF4143 0.98
PF00581Rhodanese 0.98
PF13211DUF4019 0.98
PF00903Glyoxalase 0.98
PF01040UbiA 0.98
PF13518HTH_28 0.98
PF14384BrnA_antitoxin 0.98
PF09626DHC 0.98
PF00872Transposase_mut 0.98
PF01850PIN 0.98
PF00109ketoacyl-synt 0.98
PF00215OMPdecase 0.98
PF11794HpaB_N 0.98
PF05228CHASE4 0.98
PF01077NIR_SIR 0.98
PF13181TPR_8 0.98
PF13899Thioredoxin_7 0.98
PF13751DDE_Tnp_1_6 0.98
PF00037Fer4 0.98
PF12681Glyoxalase_2 0.98
PF11903ParD_like 0.98
PF01613Flavin_Reduct 0.98
PF13649Methyltransf_25 0.98
PF04116FA_hydroxylase 0.98
PF08734GYD 0.98
PF00815Histidinol_dh 0.98
PF10056DUF2293 0.98
PF02899Phage_int_SAM_1 0.98
PF13185GAF_2 0.98
PF02361CbiQ 0.98
PF13173AAA_14 0.98

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 102 Family Scaffolds
COG1942Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase familySecondary metabolites biosynthesis, transport and catabolism [Q] 2.94
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 1.96
COG0141Histidinol dehydrogenaseAmino acid transport and metabolism [E] 0.98
COG0256Ribosomal protein L18Translation, ribosomal structure and biogenesis [J] 0.98
COG0619ECF-type transporter transmembrane protein EcfTCoenzyme transport and metabolism [H] 0.98
COG0730Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 familyInorganic ion transport and metabolism [P] 0.98
COG1853FMN reductase RutF, DIM6/NTAB familyEnergy production and conversion [C] 0.98
COG3000Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamilyLipid transport and metabolism [I] 0.98
COG3322Extracellular (periplasmic) sensor domain CHASE (specificity unknown)Signal transduction mechanisms [T] 0.98
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.98
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 0.98
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.98
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.98

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.35 %
UnclassifiedrootN/A17.65 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2100351011|ASMM170b_GM97KZC01CB50UAll Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda513Open in IMG/M
3300000242|TDF_OR_ARG05_123mDRAFT_1018197All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1717Open in IMG/M
3300003830|Ga0051980_10089993All Organisms → cellular organisms → Bacteria1839Open in IMG/M
3300003988|Ga0055475_10000126All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria10489Open in IMG/M
3300004026|Ga0055443_10258923All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geotalea → Geotalea daltonii559Open in IMG/M
3300005145|Ga0068713_1000046All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae209433Open in IMG/M
3300005588|Ga0070728_10014848All Organisms → cellular organisms → Bacteria → Proteobacteria6157Open in IMG/M
3300005588|Ga0070728_10106636All Organisms → cellular organisms → Bacteria → Proteobacteria1666Open in IMG/M
3300005588|Ga0070728_10176704All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1211Open in IMG/M
3300005589|Ga0070729_10042625All Organisms → cellular organisms → Bacteria3061Open in IMG/M
3300005589|Ga0070729_10071613All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae2187Open in IMG/M
3300005590|Ga0070727_10108411All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales1592Open in IMG/M
3300005600|Ga0070726_10018433All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda4355Open in IMG/M
3300005600|Ga0070726_10101958All Organisms → cellular organisms → Bacteria1511Open in IMG/M
3300005601|Ga0070722_10602547Not Available500Open in IMG/M
3300005609|Ga0070724_10038405All Organisms → cellular organisms → Bacteria2121Open in IMG/M
3300005609|Ga0070724_10166268All Organisms → cellular organisms → Bacteria956Open in IMG/M
3300005609|Ga0070724_10252687Not Available769Open in IMG/M
3300005612|Ga0070723_10046502All Organisms → cellular organisms → Bacteria → Proteobacteria1707Open in IMG/M
3300005920|Ga0070725_10039119Not Available2101Open in IMG/M
3300006467|Ga0099972_10043459All Organisms → cellular organisms → Bacteria → Proteobacteria3287Open in IMG/M
3300006467|Ga0099972_10609658All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda590Open in IMG/M
3300006467|Ga0099972_10618359All Organisms → cellular organisms → Bacteria1145Open in IMG/M
3300006467|Ga0099972_10811530All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300006467|Ga0099972_13109088Not Available796Open in IMG/M
3300007896|Ga0111484_1109343All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda536Open in IMG/M
3300008062|Ga0114372_1005287All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda958Open in IMG/M
3300009033|Ga0102956_1294568All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda559Open in IMG/M
3300009034|Ga0115863_1017923All Organisms → cellular organisms → Bacteria → Proteobacteria9741Open in IMG/M
3300009035|Ga0102958_1385765Not Available502Open in IMG/M
3300009060|Ga0102962_1209978All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda558Open in IMG/M
3300009105|Ga0117905_1032313All Organisms → cellular organisms → Bacteria3053Open in IMG/M
3300009135|Ga0118736_10010124All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae2083Open in IMG/M
3300009150|Ga0114921_10206438All Organisms → cellular organisms → Bacteria1373Open in IMG/M
3300009320|Ga0117909_1074143All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae3970Open in IMG/M
3300009320|Ga0117909_1277653All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300009488|Ga0114925_11243656All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda548Open in IMG/M
3300009506|Ga0118657_10079256All Organisms → cellular organisms → Bacteria4897Open in IMG/M
3300009509|Ga0123573_10161434All Organisms → cellular organisms → Bacteria2237Open in IMG/M
3300009788|Ga0114923_10435417Not Available970Open in IMG/M
3300010392|Ga0118731_103666614All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda830Open in IMG/M
3300010392|Ga0118731_106123265All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda1126Open in IMG/M
3300010392|Ga0118731_106191743All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1857Open in IMG/M
3300010392|Ga0118731_109551525All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1571Open in IMG/M
3300010392|Ga0118731_110642178All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda510Open in IMG/M
3300010392|Ga0118731_110832027Not Available863Open in IMG/M
3300010392|Ga0118731_115264230All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1194Open in IMG/M
3300010430|Ga0118733_100789951All Organisms → cellular organisms → Bacteria1892Open in IMG/M
3300010430|Ga0118733_101181195All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium1528Open in IMG/M
3300010430|Ga0118733_106616435Not Available604Open in IMG/M
3300013098|Ga0164320_10152640Not Available1040Open in IMG/M
3300013098|Ga0164320_10436024Not Available656Open in IMG/M
3300014903|Ga0164321_10154695All Organisms → cellular organisms → Bacteria → Proteobacteria1012Open in IMG/M
3300014903|Ga0164321_10215061All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda881Open in IMG/M
3300022201|Ga0224503_10284458All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda547Open in IMG/M
3300022220|Ga0224513_10446613All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda525Open in IMG/M
(restricted) 3300022913|Ga0233404_10088948Not Available725Open in IMG/M
(restricted) 3300022938|Ga0233409_10000792All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae5882Open in IMG/M
(restricted) 3300022938|Ga0233409_10142968All Organisms → cellular organisms → Bacteria783Open in IMG/M
(restricted) 3300023089|Ga0233408_10010660All Organisms → cellular organisms → Bacteria1206Open in IMG/M
(restricted) 3300024062|Ga0255039_10358502All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda627Open in IMG/M
(restricted) 3300024338|Ga0255043_10088220All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1005Open in IMG/M
3300024429|Ga0209991_10018120All Organisms → cellular organisms → Bacteria3407Open in IMG/M
(restricted) 3300024519|Ga0255046_10022603All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2251Open in IMG/M
(restricted) 3300024519|Ga0255046_10332578Not Available713Open in IMG/M
(restricted) 3300024528|Ga0255045_10117112All Organisms → cellular organisms → Bacteria → PVC group985Open in IMG/M
3300025016|Ga0210014_1205149Not Available552Open in IMG/M
3300025129|Ga0210027_1259116Not Available614Open in IMG/M
3300025565|Ga0210110_1004653All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3826Open in IMG/M
3300025841|Ga0210028_1107221All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium CG07_land_8_20_14_0_80_52_141030Open in IMG/M
3300025844|Ga0210036_1287238Not Available527Open in IMG/M
3300027536|Ga0209163_1000562All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae64826Open in IMG/M
3300027758|Ga0209379_10072855All Organisms → cellular organisms → Bacteria1268Open in IMG/M
3300027758|Ga0209379_10080794All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter1189Open in IMG/M
3300027758|Ga0209379_10158985All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium SEEP-SAG9792Open in IMG/M
3300027790|Ga0209273_10015392All Organisms → cellular organisms → Bacteria → Proteobacteria3884Open in IMG/M
3300027820|Ga0209578_10160830All Organisms → cellular organisms → Bacteria → PVC group1085Open in IMG/M
3300027820|Ga0209578_10557611All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium SEEP-SAG9510Open in IMG/M
3300027828|Ga0209692_10145565All Organisms → cellular organisms → Bacteria → Proteobacteria1123Open in IMG/M
3300027845|Ga0209271_10013342All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales3270Open in IMG/M
(restricted) 3300027861|Ga0233415_10042577All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1876Open in IMG/M
(restricted) 3300027865|Ga0255052_10580245All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda550Open in IMG/M
(restricted) 3300027868|Ga0255053_10034471Not Available2424Open in IMG/M
(restricted) 3300027881|Ga0255055_10263000All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda934Open in IMG/M
(restricted) 3300027881|Ga0255055_10528156Not Available633Open in IMG/M
3300027917|Ga0209536_100071582All Organisms → cellular organisms → Bacteria4466Open in IMG/M
3300027917|Ga0209536_100493051All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales1529Open in IMG/M
3300027967|Ga0209272_10107272All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda999Open in IMG/M
3300027978|Ga0209165_10124742All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda900Open in IMG/M
3300027980|Ga0209475_10207589All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda876Open in IMG/M
3300028599|Ga0265309_10424498All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda875Open in IMG/M
3300028600|Ga0265303_10121318All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1940Open in IMG/M
3300031275|Ga0307437_1018013All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium2932Open in IMG/M
3300032173|Ga0315268_10140906All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria2287Open in IMG/M
3300032231|Ga0316187_10170846All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1688Open in IMG/M
3300032251|Ga0316198_10666096All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda559Open in IMG/M
3300032252|Ga0316196_10417449Not Available574Open in IMG/M
3300032258|Ga0316191_10767143All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda699Open in IMG/M
3300032258|Ga0316191_11109898All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → unclassified Desulfobacterales → Desulfobacterales bacterium572Open in IMG/M
3300032260|Ga0316192_10080647All Organisms → cellular organisms → Bacteria2284Open in IMG/M
3300032263|Ga0316195_10457820All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300033429|Ga0316193_11412114All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacterales incertae sedis → Candidatus Desulfatibia → Candidatus Desulfatibia profunda552Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment27.45%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine11.76%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater8.82%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater4.90%
AquiferEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Aquifer3.92%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface3.92%
SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Sediment3.92%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow3.92%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment3.92%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.94%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands2.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.94%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment1.96%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.96%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment1.96%
Enrichment CultureEngineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture1.96%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.98%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.98%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine0.98%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.98%
Sediment, IntertidalEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal0.98%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment0.98%
Coastal Water And SedimentEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment0.98%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.98%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.98%
Marine SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Sediment0.98%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment0.98%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2100351011Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from medium methane PC12-240-170cmEnvironmentalOpen in IMG/M
3300000242Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3mEnvironmentalOpen in IMG/M
3300003830Groundwater microbial communities from aquifer in Utah, USA - Crystal Geyser 4/9/14 3 um filterEnvironmentalOpen in IMG/M
3300003988Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordB_D2EnvironmentalOpen in IMG/M
3300004026Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordC_D2EnvironmentalOpen in IMG/M
3300005145Enrichment culture microbial communities om Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS2 (Arthur Kill Sulfidogenic replicate 2) MetaGEngineeredOpen in IMG/M
3300005588Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1EnvironmentalOpen in IMG/M
3300005589Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2EnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005600Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1EnvironmentalOpen in IMG/M
3300005601Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1EnvironmentalOpen in IMG/M
3300005609Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1EnvironmentalOpen in IMG/M
3300005612Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2EnvironmentalOpen in IMG/M
3300005920Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2EnvironmentalOpen in IMG/M
3300006467Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935EnvironmentalOpen in IMG/M
3300007896Microbial communities from sediment of the River Tyne Estuary, UK ? Live_176d_3EnvironmentalOpen in IMG/M
3300008062Marine sediment microbial communities from shallow-sea hydrothermal vent, Milos, Greece - SG7EnvironmentalOpen in IMG/M
3300009033Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_D2_MGEnvironmentalOpen in IMG/M
3300009034Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, KoreaEnvironmentalOpen in IMG/M
3300009035Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_D1_MGEnvironmentalOpen in IMG/M
3300009060Salt pond soil microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_D2_MGEnvironmentalOpen in IMG/M
3300009105Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 900m, 2.7-0.2um, replicate aEnvironmentalOpen in IMG/M
3300009135Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 382 cmbsfEnvironmentalOpen in IMG/M
3300009150Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaGEnvironmentalOpen in IMG/M
3300009320Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 900m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300009488Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaGEnvironmentalOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300009509Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_11EnvironmentalOpen in IMG/M
3300009788Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaGEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300013098Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cmEnvironmentalOpen in IMG/M
3300014903Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cmEnvironmentalOpen in IMG/M
3300022201Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21EnvironmentalOpen in IMG/M
3300022220Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21EnvironmentalOpen in IMG/M
3300022913 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_2_MGEnvironmentalOpen in IMG/M
3300022938 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_13_MGEnvironmentalOpen in IMG/M
3300023089 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_11_MGEnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024338 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_9EnvironmentalOpen in IMG/M
3300024429Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024519 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27EnvironmentalOpen in IMG/M
3300024528 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_23EnvironmentalOpen in IMG/M
3300025016Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-19 (SPAdes)EnvironmentalOpen in IMG/M
3300025129Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-10 (SPAdes)EnvironmentalOpen in IMG/M
3300025565Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWB_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025841Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-13 (SPAdes)EnvironmentalOpen in IMG/M
3300025844Groundwater microbial communities from Crystal Geyser aquifers in Utah, USA - Crystal Geyser metaG 2015-15 (SPAdes)EnvironmentalOpen in IMG/M
3300027536Enrichment culture microbial communities om Arthur Kill intertidal strait, New Jersey, USA, that are MTBE-degrading - MTBE-AKS2 (Arthur Kill Sulfidogenic replicate 2) MetaG (SPAdes)EngineeredOpen in IMG/M
3300027758Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027790Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027820Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027828Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027845Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027865 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_21EnvironmentalOpen in IMG/M
3300027868 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22EnvironmentalOpen in IMG/M
3300027881 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27EnvironmentalOpen in IMG/M
3300027917Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes)EnvironmentalOpen in IMG/M
3300027967Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 (SPAdes)EnvironmentalOpen in IMG/M
3300027978Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 (SPAdes)EnvironmentalOpen in IMG/M
3300027980Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 (SPAdes)EnvironmentalOpen in IMG/M
3300028599Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300028600Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300031275Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-90EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032231Coastal sediment microbial communities from Maine, United States - Cross River worm burrow 1EnvironmentalOpen in IMG/M
3300032251Coastal sediment microbial communities from Oude Bieten Haven, Netherlands - site A anoxicEnvironmentalOpen in IMG/M
3300032252Coastal sediment microbial communities from Maine, United States - Eddy sediment 2 cmEnvironmentalOpen in IMG/M
3300032258Coastal sediment microbial communities from Maine, United States - Eddy worm burrow 2 cmEnvironmentalOpen in IMG/M
3300032260Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrowEnvironmentalOpen in IMG/M
3300032263Coastal sediment microbial communities from Maine, United States - Phippsburg sediment 1EnvironmentalOpen in IMG/M
3300033429Coastal sediment microbial communities from Maine, United States - Merrow Island sediment 2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ASMM170b_072903702100351011Coastal Water And SedimentVLSENQRKLFADFHNSVEAEGILDEKTSHLIKVAAAMAFGCYP
TDF_OR_ARG05_123mDRAFT_101819743300000242MarineMLSENQRKIFGDFHESVEAERILDEKTSHMIKVAAAMAFGCYP*
Ga0051980_1008999323300003830GroundwaterMLSENQQRLFAEFHKSIEGEGILDGKTSHLIKVAAAMAFGCYP*
Ga0055475_1000012643300003988Natural And Restored WetlandsMLSENQREIFADFHRSVEAEGVLDEKTSHMIKLAVAMALGCYP*
Ga0055443_1025892313300004026Natural And Restored WetlandsVLSENQRKLFADFHNSVEAEGILDEKTSHLIKVAAAMVFGCYP*
Ga0068713_10000461743300005145Enrichment CultureMLSENQRKLFSEFHKSIEAEGILDEKTSHLIKVAAAMAIGCYP*
Ga0070728_10014848103300005588Marine SedimentMLSENQREIFADFHKSVDAEGTLDEKTSHMIKVAAAMAFGCYP*
Ga0070728_1010663633300005588Marine SedimentMISENQRRLFADFHKSVEAEGILDEKTSHLIKVALAMAFGCYP*
Ga0070728_1017670423300005588Marine SedimentVLSENQRKLFADFHNSVEAEGILDEKTSHLIKVAAAMAFGCYP*
Ga0070729_1004262533300005589Marine SedimentMLSENQRKIFADFHQSVEAEGILDEKTSHMIKVAAAMAFGCYP*
Ga0070729_1007161313300005589Marine SedimentMLSENQRKLFADFHKSVDAEGILDEKMSHLIKVAAAMAFGCYP*
Ga0070727_1010841123300005590Marine SedimentMLSENQRNIFADFHKSVEAEGALDEKTSHMIKVAAAMAFGCYP*
Ga0070726_1001843323300005600Marine SedimentMLSENQRKIFAEFHKSVEVEKALDEKTSHLIKVAAAMAFGCYP*
Ga0070726_1010195833300005600Marine SedimentMLSENQRELFADFYKSVEAEGILDEKTSHLIKIAAAMAFGCYP*
Ga0070722_1060254713300005601Marine SedimentMLSENQRKLFADFHKSVETEGILDEKTSHLIKIAAAMAFACYP*MEHL
Ga0070724_1003840533300005609Marine SedimentMLSENQRKIFADFHKSVEAEGILNEKTSHMIKMAAAIAFGCYP*
Ga0070724_1016626833300005609Marine SedimentMLSENQRNIFADFHKSVEVEGALDEKTSHMIKVAAAMAFGC
Ga0070724_1025268713300005609Marine SedimentVLSENQRKLFADFHNSVEAEGILDEKTSHLIKVAA
Ga0070723_1004650223300005612Marine SedimentMLSENQRKIFADFHESIEAEGILDEKTSHMIKVAAAMAFACYP*
Ga0070725_1003911923300005920Marine SedimentMLSENQRKIFADFHQSVEVEGILDEKMSHMIKVAAAMAFGCYP*
Ga0099972_1004345933300006467MarineMLSENQRKIFADFHKLVENEGILDEKTSHMIKMAAAIAFGCYP*
Ga0099972_1060965813300006467MarineSVLSENQRKLFADFHNSVEAEGILDEKTSHLIKVAAAMAFGCYP*
Ga0099972_1061835913300006467MarineMLSENQRKLFADFHKSVETEGILDEKTSHLIKIAAAMAFACYP*
Ga0099972_1081153013300006467MarineMLSENQQKIFADFHKSVEAEGALDDKTSHMIKMAAAIAFGCYP*
Ga0099972_1310908813300006467MarineVLSENQRKLFADFHNSVEAEGILDEKTSHLIKVAAAMAFGC
Ga0111484_110934323300007896SedimentMDVFLGKEKSMISENQRKIFADFHKSVEAEGALDDKTSHMIKMAAAIAFGCYP*
Ga0114372_100528713300008062Marine SedimentMLSENQRKLFADFHNSVEAEGILDEKTSHMIKVAAAMAFGCYP*
Ga0102956_129456813300009033SoilLSENQRKIFADFHNSVDAEGTLDEKTSHMIKVAAAMAFGCYS*
Ga0115863_1017923103300009034Sediment, IntertidalMLSGNQRKLFADFHKSVETEGILDEKTSHLIKIAAAMAFACYP*
Ga0102958_138576523300009035SoilMLSENQRKLFADFYKTAEAEGILDEKTSHLIKIAAAMAFACYP*
Ga0102962_120997813300009060SoilMLFENQRKIFADFHKSVEAEGVLDEKTSHLIKVAAAMSLGCYP*
Ga0117905_103231343300009105MarineMLSENQQSLFADFHKSVEAEGILDAKTSHLIKVAAAMAFGCYP*
Ga0118736_1001012453300009135Marine SedimentMLSENQRELFADFHKSVEAEGILDEKTSHLIKVAAAMAFGCYP*
Ga0114921_1020643843300009150Deep SubsurfaceMLSENQRKLFADFHKSVEAEGILDEKTSHLIKVAAAMAFGCYP*
Ga0117909_107414343300009320MarineMLSENQRKLFANFHKSVEAEGILDGKTSHLIKIAAAMAFGCYP*
Ga0117909_127765343300009320MarineMLSENQRKLFADFHKSAEAEGILDEKTSHLIKVAAAMAFGCYP*
Ga0114925_1124365623300009488Deep SubsurfaceMLSENQRKLFTDFHKSVEAEGILDEKTSHLIKVAAAMAFGCYP*
Ga0118657_1007925643300009506Mangrove SedimentMEKSMLSEKQRKIFADFHKSIEAEGALDDKTSHIVKITAAMAFGCYP*
Ga0123573_1016143453300009509Mangrove SedimentMLSESQPKLFADFHESVEAEGILDEKTAHMIKVAAAMAFACYP*
Ga0114923_1043541723300009788Deep SubsurfaceMLSENQRKIFADFHKSVEAEGILDQKTSHLIKVAAAMAFGCYP*
Ga0118731_10366661413300010392MarineMLSENQRKLFADFYKTVEAEGILDEKTSHLIKVAAAMAFGCYP*
Ga0118731_10612326533300010392MarineMDIFFGKEKSMLSENQQKIFADFHKSVEAEGALDDKTSHMIKMAAAIAFGCYP*
Ga0118731_10619174313300010392MarineVLSENQRKIFADFHNSVDAEGTFDEKTSHMIKVAAAMAFGCYP*
Ga0118731_10955152513300010392MarineMLSENQRKIFADFHKSVEAEGFLDQKTSHLIKVAAAMAFGCYP*
Ga0118731_11064217813300010392MarineMLAESQRKIFADFHKSVEAEGILDEKTSHMIKVAAAMAFGCYP*
Ga0118731_11083202713300010392MarineMLSENQRKIFADFHKSVEAEGILDEKTSHMIKVAAAMAFGCYP*
Ga0118731_11526423033300010392MarineMLSENQRNIFADFHKSVEAEGALDEKTSHMIKVAAAMAFG
Ga0118733_10078995133300010430Marine SedimentMDIFFGKEKSMLSENQQKIFADFHKSVEAEGALDDKTSHMIKMAAAIAFCCYP*
Ga0118733_10118119543300010430Marine SedimentMDVFSGKEKSMLSENQREIFAAFHKSVEAEGALDDKTSHMVKIAAAIAFGCYP*
Ga0118733_10661643513300010430Marine SedimentGEEKSMLSENQRKIFADFHESVEAEGILDEKTSHMIKVAAAMAFGCYP*
Ga0164320_1015264033300013098Marine SedimentMLSENQRKIFADFHKSVEAEGILDQKTSHLIKVAAAMAFGCDP*
Ga0164320_1043602423300013098Marine SedimentMLSENQRKLFADFHKSVEAEGILDEKTSHLIKIAAAMAFACYP*
Ga0164321_1015469533300014903Marine SedimentMLSENQRKLFADFHKSVEAEGILDEKTSHLIKVASAMAFGCYP*
Ga0164321_1021506123300014903Marine SedimentMLSENQRKIFADFHESVEAEGILGEKTSHMIKVAAAMAFGCYP*
Ga0224503_1028445823300022201SedimentKSMLSENQRKIFADFHKSVEAEGALDEKTSHMIKVAAAMAFGCYP
Ga0224513_1044661313300022220SedimentVLSENQRKLFADFHNSVEAEGILDEKTSHLIKVAAAMVFGCYP
(restricted) Ga0233404_1008894813300022913SeawaterMLSENQRKIFGDFHESVEAERILDEKTSHMIKVAAAMAFGCYP
(restricted) Ga0233409_1000079283300022938SeawaterMLSENQRKLFADFHKSVEAEGILDEKTSHLIKVAAAMAFGCYP
(restricted) Ga0233409_1014296823300022938SeawaterMLSENQRKLFADFHKSAEAEGILDEKTSHLIKVAAAMAFGCYP
(restricted) Ga0233408_1001066043300023089SeawaterMLSENQRKIFADFHKSVEAEGILDEKTAHLIKVAAAMAFGCYP
(restricted) Ga0255039_1035850213300024062SeawaterMLSENQRKIFADFHKSVEAEGILDQKTSHLIKVAAAMAFGCYP
(restricted) Ga0255043_1008822033300024338SeawaterMLSENQRKIFADFHKSVEAEGILDEKTSHMIKVAAAMAFGCYP
Ga0209991_1001812023300024429Deep SubsurfaceMLSENQRKLFTDFHKSVEAEGILDEKTSHLIKVAAAMAFGCYP
(restricted) Ga0255046_1002260323300024519SeawaterMLDENQRKIFADFHKSVEAEGILDEKTSHMIKVAAAMAFGCYP
(restricted) Ga0255046_1033257813300024519SeawaterMLSENQRKLFADFHKSVEAEGILDEKTSHLIKIAAAMAFACYP
(restricted) Ga0255045_1011711213300024528SeawaterMLSENQRKIFAEFHKSVEVERALDEKTSHLIKVAAAMAFGCY
Ga0210014_120514923300025016AquiferMLSENQQRLFAEFHKSIEGEGILDGKTSHLIKVAAAMAFGCYP
Ga0210027_125911613300025129AquiferMLSENQQRLFAEFHKSIEGEGILDGKTSHLIKVAAAM
Ga0210110_100465353300025565Natural And Restored WetlandsMLSENQREIFADFHRSVEAEGVLDEKTSHMIKLAVAMALGCYP
Ga0210028_110722123300025841AquiferMLSENQQRLFAEFHKSIEGEWILDGKTSHLIKVAAAMAFGCYP
Ga0210036_128723813300025844AquiferMLSENQQRLFAEFHKSIEGEGILDGKTSHLIKVAAAMAFGCYPXMEH
Ga0209163_1000562223300027536Enrichment CultureMLSENQRKLFSEFHKSIEAEGILDEKTSHLIKVAAAMAIGCYP
Ga0209379_1007285523300027758Marine SedimentMLSENQRKIFADFHKSVEAEGILNEKTSHMIKMAAAIAFGCYP
Ga0209379_1008079413300027758Marine SedimentMLSENQREIFADFHKSVDAEGTLDEKTSHMIKVAAAMAFGCYP
Ga0209379_1015898533300027758Marine SedimentMLSENQRKIFADFHKLVENEGILDEKTSHMIKMAAAIAFGCYP
Ga0209273_1001539223300027790Marine SedimentMLSENQRKIFADFHQSVEAEGILDEKTSHMIKVAAAMAFGCYP
Ga0209578_1016083033300027820Marine SedimentMDIFFGKEKSMLSENQQKIFADFHKSVEAEGALDDKTSHMIKMAAAIAFGCYP
Ga0209578_1055761113300027820Marine SedimentMLSENQRKIFADFHKLVENEGILDEKTSHMIKMAAAIA
Ga0209692_1014556513300027828Marine SedimentMISENQRRLFADFHKSVEAEVILDEKTSHLIKVALAMAFGCYP
Ga0209271_1001334263300027845Marine SedimentMISENQRRLFADFHKSVEAEGILDEKTSHLIKVALAMAFGCYP
(restricted) Ga0233415_1004257753300027861SeawaterMLSENQRELFADFHKSVEAEGILDEKTSHLIKVAAAMAFGCYP
(restricted) Ga0255052_1058024533300027865SeawaterKEKSVLSENQRKLFADFHNSVEAEGILDEKTSHLIKVAAAMAFGCYP
(restricted) Ga0255053_1003447143300027868SeawaterMLSENQRKIFADFHESVEAEGILDEKTSHMIKVAAAMAFGCYP
(restricted) Ga0255055_1026300023300027881SeawaterMLSENQRKIFADFHQSVEAEGILGEKTSHMIKVAAAMAFGCYP
(restricted) Ga0255055_1052815623300027881SeawaterMLSENQRKIFADFHQSVEAEGILDEKTSHMIKVAAAMAFGCYPXMEHLL
Ga0209536_10007158223300027917Marine SedimentMLSENQRKIFADFHESVEAEEILDKKTSHMIKVAAAMAFGCYP
Ga0209536_10049305113300027917Marine SedimentVLSEIQRKLFADFHNSVEAEGIFDEKTSHLIKVAAAMAFGCYP
Ga0209272_1010727233300027967Marine SedimentMLSENQQKIFADFHKSVEAEGALDDKTSHMIKMAAAIAFGCYP
Ga0209165_1012474223300027978Marine SedimentMLSENQRNIFADFHKSVEAEGALDEKTSHMIKVAAAMAFGCYP
Ga0209475_1020758923300027980Marine SedimentMLSENQRKLFADFHKSVDAEGILDEKMSHLIKVAAAMAFGCYP
Ga0265309_1042449823300028599SedimentVLSENQRKLFADFHNSVEAEGILDEKTSHLIKVAATMAFGCYP
Ga0265303_1012131813300028600SedimentVLSENQRKIFADFHNSVDAEGTFDEKTSHMIKVAAAMAFGCYP
Ga0307437_101801323300031275Salt MarshMLSENQRKIFADFHKSVEAEGILNEKTSHMIKMAAAIAFGRYP
Ga0315268_1014090643300032173SedimentMLSENQKKKFADFHKSVEVEGVLDEKTSHMIRLAAAMAFGCYP
Ga0316187_1017084653300032231Worm BurrowMLSENQRKIFAEFHKSVEVERALDEKTSHLIKVAAAMAFGCYP
Ga0316198_1066609623300032251SedimentMLSDNQRKTFADFHKLVENEGILNEKTSHMIKMAAAMAFGCYP
Ga0316196_1041744913300032252SedimentVLSENQRKIFADFHNSVDAEGTLDEKTSHMIKVAAAMAFGCYS
Ga0316191_1076714323300032258Worm BurrowMLSENQRKIFAEFHKSVEVERAFDEKTSHLIKVAAAMAFGCYP
Ga0316191_1110989813300032258Worm BurrowMLSENQRKLFADFYKTVEAEGILDEKTSHLIKVAAAMAFGCYP
Ga0316192_1008064723300032260Worm BurrowMLSENQRELFADFYKSVEAEGILDEKTSHLIKIAAAMAFGCYP
Ga0316195_1045782023300032263SedimentMLSENQRNLFADFHKSVEAEGILDAKTSHLIKIAAAMAFGCYP
Ga0316193_1141211413300033429SedimentRKEKSMLSENQRKLFADFYKTVEAEGILDEKTSHLIKVAAAMAFGCYP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.