Scaffold 2007534805

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold 2007534805

Scaffold 2007534805

Overview

Basic Information
Taxon OID	2007427000 Open in IMG/M
Scaffold ID	2007534805 Open in IMG/M
Source Dataset Name	Uranium contaminated groundwater from Oak Ridge Integrated Field Research Center, Tennessee
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	861
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater → Groundwater Microbial Communities From Oak Ridge Integrated Field Research Center, Tennessee, That Are Pristine And Uranium Contaminated

Source Dataset Sampling Location
Location Name	DOE Field Research Center Area 3 Well FW106, Oakridge, TN
Coordinates	Lat. (^o)	36.11569	Long. (^o)	-84.248657	Alt. (m)		Depth (m)	21
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050967	Metagenome / Metatranscriptome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
2007564094	F050967	N/A	MEKPPIRKDYFEAECGCRQWYESVPGGPVEELEEVVEYCEMHDVESGSA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.