Scaffold ACEF_F3GTV4A02F8DYE

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold ACEF_F3GTV4A02F8DYE

Scaffold ACEF_F3GTV4A02F8DYE

Overview

Basic Information
Taxon OID	2029527004 Open in IMG/M
Scaffold ID	ACEF_F3GTV4A02F8DYE Open in IMG/M
Source Dataset Name	Atta cephalotes fungus garden (ACEF)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	512
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Atta Cephalotes Fungus Garden → Atta Cephalotes Fungus Garden Microbial Communities From Gamboa, Panama

Source Dataset Sampling Location
Location Name	Gamboa, Panama
Coordinates	Lat. (^o)	9.1167	Long. (^o)	-79.7	Alt. (m)		Depth (m)	.5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010740	Metagenome	300	Y

Sequences

Protein ID	Family	RBS	Sequence
ACEFG_630550	F010740	AGAAG	MAFMDRKRNTDTAKNGYQIPMYQGGPPHEPYFIAIDNQDQIIIGPSKKIMAMHVVG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.