NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ACEF_contig14626

Scaffold ACEF_contig14626


Overview

Basic Information
Taxon OID2029527004 Open in IMG/M
Scaffold IDACEF_contig14626 Open in IMG/M
Source Dataset NameAtta cephalotes fungus garden (ACEF)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)506
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Atta Cephalotes Fungus Garden → Atta Cephalotes Fungus Garden Microbial Communities From Gamboa, Panama

Source Dataset Sampling Location
Location NameGamboa, Panama
CoordinatesLat. (o)9.1167Long. (o)-79.7Alt. (m)Depth (m).5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036993Metagenome169Y

Sequences

Protein IDFamilyRBSSequence
ACEFG_315210F036993N/AYPIKMYQGGTPHEPFFIAIDCRSQVIIGPNKKIVATHVVGELEVLV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.