Scaffold ACOD_F95O9CU02GV1XT

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold ACOD_F95O9CU02GV1XT

Scaffold ACOD_F95O9CU02GV1XT

Overview

Basic Information
Taxon OID	2038011000 Open in IMG/M
Scaffold ID	ACOD_F95O9CU02GV1XT Open in IMG/M
Source Dataset Name	Fungus garden microbial communities from Atta colombica in Panama - from dump top
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	454 Life Sciences, DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	506
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden → Fungus Garden Microbial Communities From Leaf-Cutting Ants In Gamboa, Panama

Source Dataset Sampling Location
Location Name	Gamboa, Panama
Coordinates	Lat. (^o)	9.1167	Long. (^o)	-79.7	Alt. (m)		Depth (m)	.5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002255	Metagenome / Metatranscriptome	578	Y

Sequences

Protein ID	Family	RBS	Sequence
ACODT_13649140	F002255	AGGAGG	MKRLLLGLALAAAVAYALRDWFAAPQPHPSWEETDNDPEDMSLDLAQRAREAEGAQAAEESETPAT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.