Scaffold 2044924125

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold 2044924125

Scaffold 2044924125

Overview

Basic Information
Taxon OID	2044078008 Open in IMG/M
Scaffold ID	2044924125 Open in IMG/M
Source Dataset Name	Mixed alcohol bioreactor microbial communities from Texas A and M University - 55C, Day 16
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	10216
Total Scaffold Genes	21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	17 (80.95%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Mixed Alcohol Bioreactor → Mixed Alcohol Bioreactor Microbial Communities From Texas A&M University

Source Dataset Sampling Location
Location Name	Texas A and M University College Station, Texas, USA
Coordinates	Lat. (^o)	30.620833	Long. (^o)	-96.341111	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088752	Metagenome / Metatranscriptome	109	N

Sequences

Protein ID	Family	RBS	Sequence
2044972271	F088752	AGGA	MKGLQSVYDQIINILKENNVLINITPPRPYLIKKDDEERINAEAEDLFKKCKIEEYNSKMKEKEAYKLYFDEAYKYTNFYEEGDE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.