Scaffold mhc6b_MHC6B_contig02440

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold mhc6b_MHC6B_contig02440

Scaffold mhc6b_MHC6B_contig02440

Overview

Basic Information
Taxon OID	2051223007 Open in IMG/M
Scaffold ID	mhc6b_MHC6B_contig02440 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from Orebro University Hospital, Sweden - Sample 10375
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Maryland School of Medicine
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2028
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Orebro University Hospital, Sweden, Of Individuals With Crohns Disease

Source Dataset Sampling Location
Location Name	Orebro University Hospital, Sweden
Coordinates	Lat. (^o)	59.274717	Long. (^o)	15.230656	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076064	Metagenome	118	N

Sequences

Protein ID	Family	RBS	Sequence
MHC6B_contig02440_metagene_gene_4	F076064	N/A	LKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLSRLFSARRQIRLCAPDLKRRNETRRHPMPVLKLY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.