NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F076064

Metagenome Family F076064

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F076064
Family Type Metagenome
Number of Sequences 118
Average Sequence Length 118 residues
Representative Sequence LKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY
Number of Associated Samples 113
Number of Associated Scaffolds 118

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.69 %
% of genes near scaffold ends (potentially truncated) 28.81 %
% of genes from short scaffolds (< 2000 bps) 37.29 %
Associated GOLD sequencing projects 108
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal
(43.220 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal distal gut
(57.627 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.54%    β-sheet: 0.84%    Coil/Unstructured: 54.62%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 118 Family Scaffolds
PF12728HTH_17 22.03
PF00589Phage_integrase 6.78
PF12099DUF3575 6.78
PF16249DUF4906 5.93
PF13102Phage_int_SAM_5 4.24
PF02371Transposase_20 1.69
PF09603Fib_succ_major 1.69
PF11066DUF2867 0.85
PF00704Glyco_hydro_18 0.85
PF01555N6_N4_Mtase 0.85
PF00923TAL_FSA 0.85
PF14322SusD-like_3 0.85
PF08281Sigma70_r4_2 0.85
PF03129HGTP_anticodon 0.85
PF14509GH97_C 0.85
PF16576HlyD_D23 0.85
PF03060NMO 0.85
PF09357RteC 0.85
PF04342DMT_6 0.85
PF00271Helicase_C 0.85
PF08522DUF1735 0.85
PF03992ABM 0.85
PF01926MMR_HSR1 0.85
PF02498Bro-N 0.85
PF02915Rubrerythrin 0.85
PF02321OEP 0.85
PF00691OmpA 0.85
PF14714KH_dom-like 0.85
PF12072RNase_Y_N 0.85
PF01432Peptidase_M3 0.85
PF13231PMT_2 0.85
PF04397LytTR 0.85
PF11888DUF3408 0.85

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 118 Family Scaffolds
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 1.69
COG3547TransposaseMobilome: prophages, transposons [X] 1.69
COG0124Histidyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.85
COG0176Transaldolase/fructose-6-phosphate aldolaseCarbohydrate transport and metabolism [G] 0.85
COG0339Zn-dependent oligopeptidase, M3 familyPosttranslational modification, protein turnover, chaperones [O] 0.85
COG0423Glycyl-tRNA synthetase, class IITranslation, ribosomal structure and biogenesis [J] 0.85
COG0441Threonyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.85
COG0442Prolyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.85
COG0516IMP dehydrogenase/GMP reductaseNucleotide transport and metabolism [F] 0.85
COG0863DNA modification methylaseReplication, recombination and repair [L] 0.85
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 0.85
COG1164Oligoendopeptidase FAmino acid transport and metabolism [E] 0.85
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.85
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 0.85
COG3169Uncharacterized membrane protein, DMT/DUF486 familyFunction unknown [S] 0.85
COG3617Prophage antirepressorMobilome: prophages, transposons [X] 0.85

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2051223007|mhc6b_MHC6B_contig02440All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii2028Open in IMG/M
2065487000|bke_il_velvet_contig_26829All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes shahii1777Open in IMG/M
2149837021|STU__NODE_13319_len_458_cov_29_510918All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes516Open in IMG/M
2149837021|STU__NODE_31184_len_458_cov_12_768559All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes516Open in IMG/M
2149837022|STU__NODE_5209_len_2711_cov_29_897823All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes shahii2757Open in IMG/M
3300000273|EM039_1006072All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii11735Open in IMG/M
3300000279|EM219_1033990All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii5558Open in IMG/M
3300000281|EM227_1016696All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes shahii1865Open in IMG/M
3300000286|EM268_1008458All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes shahii9827Open in IMG/M
3300000292|EM305_1004674All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes shahii4831Open in IMG/M
3300000331|EM203_1005876All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes shahii7176Open in IMG/M
3300000357|EM177_1002021All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes24705Open in IMG/M
3300006487|Ga0100256_10689All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes11237Open in IMG/M
3300006525|Ga0101027_124178All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes1153Open in IMG/M
3300006568|Ga0100215_101511All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii19946Open in IMG/M
3300006568|Ga0100215_132939All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes683Open in IMG/M
3300006747|Ga0101801_100646All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii30782Open in IMG/M
3300007043|Ga0102536_100052All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes157676Open in IMG/M
3300007111|Ga0102634_120723All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes854Open in IMG/M
3300007298|Ga0104838_133619All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes702Open in IMG/M
3300007360|Ga0104766_1000564All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes44071Open in IMG/M
3300007362|Ga0104788_103135All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes8053Open in IMG/M
3300007530|Ga0104842_100330All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes16765Open in IMG/M
3300007641|Ga0105527_119220All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes718Open in IMG/M
3300007650|Ga0105532_101816All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii10436Open in IMG/M
3300007657|Ga0105536_109832All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii2798Open in IMG/M
3300007657|Ga0105536_136794All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes590Open in IMG/M
3300007705|Ga0105636_104876All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii1718Open in IMG/M
3300007805|Ga0105637_102215All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes6920Open in IMG/M
3300007921|Ga0111562_101288All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii13724Open in IMG/M
3300008081|Ga0113559_137963All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes713Open in IMG/M
3300008268|Ga0111491_1028699All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes1183Open in IMG/M
3300008282|Ga0114156_1003912All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii5058Open in IMG/M
3300008326|Ga0115311_101253All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii15558Open in IMG/M
3300008385|Ga0114873_100397All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii34349Open in IMG/M
3300008497|Ga0111011_100415All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii34214Open in IMG/M
3300008672|Ga0111519_100481All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes59413Open in IMG/M
3300008726|Ga0113881_101078All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii8699Open in IMG/M
3300008750|Ga0114087_117525All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes735Open in IMG/M
3300010262|Ga0129317_1025659All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes1173Open in IMG/M
3300010280|Ga0129308_1016728All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes senegalensis2107Open in IMG/M
3300013752|Ga0117817_1003285All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii4578Open in IMG/M
3300013899|Ga0117808_112006All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes1175Open in IMG/M
3300013942|Ga0117795_1003014All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii3121Open in IMG/M
3300014530|Ga0169724_100697All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes24824Open in IMG/M
3300014536|Ga0134370_108558All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes1266Open in IMG/M
3300014538|Ga0134452_102665All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes3225Open in IMG/M
3300014547|Ga0134415_101699All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes senegalensis6541Open in IMG/M
3300014560|Ga0134394_101764All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii8438Open in IMG/M
3300014561|Ga0134428_100508All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii24515Open in IMG/M
3300014566|Ga0134372_1002664All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii5218Open in IMG/M
3300014572|Ga0134457_1000742All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes15554Open in IMG/M
3300014782|Ga0134389_1001562All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii8052Open in IMG/M
3300014797|Ga0134414_1002558All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii5851Open in IMG/M
3300014803|Ga0134430_1003550All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes senegalensis4302Open in IMG/M
3300014941|Ga0134385_104322All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii2406Open in IMG/M
3300014963|Ga0134523_1004220All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes18507Open in IMG/M
3300023484|Ga0257055_10856All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes12957Open in IMG/M
3300023498|Ga0257046_106103All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii4564Open in IMG/M
3300023720|Ga0257049_101397All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii16690Open in IMG/M
3300029028|Ga0169666_101640All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii10045Open in IMG/M
3300029030|Ga0169673_101357All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii10319Open in IMG/M
3300029043|Ga0169613_100124All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii77978Open in IMG/M
3300029059|Ga0169653_106585All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes finegoldii4875Open in IMG/M
3300029099|Ga0169186_112514All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes senegalensis1774Open in IMG/M
3300029115|Ga0168848_122541All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes1103Open in IMG/M
3300029132|Ga0168796_137169All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes630Open in IMG/M
3300029133|Ga0168787_102030All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii12327Open in IMG/M
3300029211|Ga0168693_113599All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes1431Open in IMG/M
3300029227|Ga0168687_100100All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii137722Open in IMG/M
3300029249|Ga0168690_1008163All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii3260Open in IMG/M
3300029254|Ga0168700_1000497All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes43850Open in IMG/M
3300029348|Ga0243800_107593All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes2406Open in IMG/M
3300029357|Ga0243847_101197All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii32400Open in IMG/M
3300029358|Ga0243818_1022817All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes1322Open in IMG/M
3300029362|Ga0243852_1061639All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes810Open in IMG/M
3300029387|Ga0243994_134250All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes839Open in IMG/M
3300029417|Ga0243409_101077All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes22654Open in IMG/M
3300029433|Ga0243761_1018878All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii1697Open in IMG/M
3300029465|Ga0244121_100077All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes150305Open in IMG/M
3300029484|Ga0244116_106791All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii3096Open in IMG/M
3300029484|Ga0244116_132783All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes601Open in IMG/M
3300029490|Ga0244171_100262All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes89086Open in IMG/M
3300029513|Ga0244810_129464All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes653Open in IMG/M
3300029530|Ga0244962_123878All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes556Open in IMG/M
3300029549|Ga0244894_119354All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes1100Open in IMG/M
3300029565|Ga0244861_102630All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii10313Open in IMG/M
3300029575|Ga0244903_100008All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes414285Open in IMG/M
3300029575|Ga0244903_131367All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii726Open in IMG/M
3300029584|Ga0245112_120888All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes senegalensis1355Open in IMG/M
3300029607|Ga0244907_117842All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes1519Open in IMG/M
3300029610|Ga0245132_107780All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii3726Open in IMG/M
3300029617|Ga0245125_101722All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii19614Open in IMG/M
3300029653|Ga0245224_100153All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes96567Open in IMG/M
3300029686|Ga0245204_122107All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes849Open in IMG/M
3300029696|Ga0245263_120047All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii1329Open in IMG/M
3300029709|Ga0245177_100155All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes133009Open in IMG/M
3300029714|Ga0245242_1000110All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes148676Open in IMG/M
3300029716|Ga0245260_1002793All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii11769Open in IMG/M
3300029737|Ga0245199_100279All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes70317Open in IMG/M
3300029783|Ga0243236_1030565All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes932Open in IMG/M
3300029789|Ga0243734_1023451All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae1494Open in IMG/M
3300029830|Ga0245137_138733All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes639Open in IMG/M
3300029854|Ga0245294_103901All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes senegalensis3156Open in IMG/M
3300029856|Ga0245296_101295All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes17086Open in IMG/M
3300029861|Ga0245310_101822All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii15908Open in IMG/M
7000000036|SRS049164_WUGC_scaffold_84180All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes657Open in IMG/M
7000000171|SRS052697_LANL_scaffold_49554All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii4577Open in IMG/M
7000000186|SRS022524_Baylor_scaffold_43724All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes904Open in IMG/M
7000000187|SRS022609_Baylor_scaffold_67467All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii6965Open in IMG/M
7000000265|SRS021948_Baylor_scaffold_4806All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes1323Open in IMG/M
7000000401|C3052597All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes605Open in IMG/M
7000000429|C2066859All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii4537Open in IMG/M
7000000475|SRS020328_Baylor_scaffold_3459All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii23135Open in IMG/M
7000000579|C2659695All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii950Open in IMG/M
7000000630|SRS062427_LANL_scaffold_6062All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii6596Open in IMG/M
7000000659|SRS015854_WUGC_scaffold_23528All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes500Open in IMG/M
7000000684|SRS019582_WUGC_scaffold_10954All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes677Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Human FecalHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal43.22%
HumanHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human33.05%
Human FecesHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Feces5.93%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated5.93%
Human Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated5.08%
Human GutHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut2.54%
Human GutHost-Associated → Human → Digestive System → Unclassified → Unclassified → Human Gut2.54%
Eastern Black-And-White Colobus Group FecalHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Eastern Black-And-White Colobus Group Fecal0.85%
Ring-Tailed Lemur Group FecalHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Ring-Tailed Lemur Group Fecal0.85%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2051223007Human fecal microbial communities from Orebro University Hospital, Sweden - Sample 10375Host-AssociatedOpen in IMG/M
2065487000Human fecal microbial communities from Baylor School of Medicine, Texas, USA, mock community - bke_il_velvetHost-AssociatedOpen in IMG/M
2149837021Human fecal microbial communities from the University of Arizona (HMP) - UAf1Host-AssociatedOpen in IMG/M
2149837022Human fecal microbial communities from the University of Arizona (HMP) - UAf2Host-AssociatedOpen in IMG/M
3300000273Human fecal microbial communities from Cork, Ireland - EM039Host-AssociatedOpen in IMG/M
3300000279Human fecal microbial communities from Cork, Ireland - EM219Host-AssociatedOpen in IMG/M
3300000281Human fecal microbial communities from Cork, Ireland - EM227Host-AssociatedOpen in IMG/M
3300000286Human fecal microbial communities from Cork, Ireland - EM268Host-AssociatedOpen in IMG/M
3300000292Human fecal microbial communities from Cork, Ireland - EM305Host-AssociatedOpen in IMG/M
3300000331Human fecal microbial communities from Cork, Ireland - EM203Host-AssociatedOpen in IMG/M
3300000357Human fecal microbial communities from Cork, Ireland - EM177Host-AssociatedOpen in IMG/M
3300006487Human stool microbial communities from NIH, USA - visit 1, subject 159591683Host-AssociatedOpen in IMG/M
3300006525Human stool microbial communities from NIH, USA - visit 2, subject 764062976Host-AssociatedOpen in IMG/M
3300006568Human stool microbial communities from NIH, USA - visit 2 of subject 765074482 replicate 2Host-AssociatedOpen in IMG/M
3300006747Human stool microbial communities from NIH, USA - visit 1, subject 160218816Host-AssociatedOpen in IMG/M
3300007043Human stool microbial communities from NIH, USA - visit 1, subject 638754422Host-AssociatedOpen in IMG/M
3300007111Human stool microbial communities from NIH, USA - visit 1, subject 158944319Host-AssociatedOpen in IMG/M
3300007298Human stool microbial communities from NIH, USA - visit 1, subject 160603188 reassemblyHost-AssociatedOpen in IMG/M
3300007360Human stool microbial communities from the National Institute of Health, USA - subject 158499257, visit 2 reassemblyHost-AssociatedOpen in IMG/M
3300007362Human stool microbial communities from NIH, USA - visit 1, subject 675950834 reassemblyHost-AssociatedOpen in IMG/M
3300007530Human stool microbial communities from NIH, USA - visit 1, subject 809635352 reassemblyHost-AssociatedOpen in IMG/M
3300007641Human stool microbial communities from NIH, USA - visit number 3 of subject 159227541 reassemblyHost-AssociatedOpen in IMG/M
3300007650Human stool microbial communities from NIH, USA - visit 1, subject 604812005 reassemblyHost-AssociatedOpen in IMG/M
3300007657Human stool microbial communities from NIH, USA - visit 2, subject 158479027 reassemblyHost-AssociatedOpen in IMG/M
3300007705Human stool microbial communities from NIH, USA - visit 1, subject 160158126 reassemblyHost-AssociatedOpen in IMG/M
3300007805Human stool microbial communities from NIH, USA - visit 1, subject 508703490 reassemblyHost-AssociatedOpen in IMG/M
3300007921Human stool microbial communities from NIH, USA - visit 1, subject 160704339 reassemblyHost-AssociatedOpen in IMG/M
3300008081Human stool microbial communities from NIH, USA - visit 2, subject 765074482 replicate 1 reassemblyHost-AssociatedOpen in IMG/M
3300008268Human stool microbial communities from NIH, USA - visit 1, subject 158499257 reassemblyHost-AssociatedOpen in IMG/M
3300008282Human stool microbial communities from NIH, USA - visit 1, subject 159166850 reassemblyHost-AssociatedOpen in IMG/M
3300008326Human stool microbial communities from NIH, USA - visit 1, subject 158458797 reassemblyHost-AssociatedOpen in IMG/M
3300008385Human stool microbial communities from NIH, USA - visit number 3 of subject 763536994 reassemblyHost-AssociatedOpen in IMG/M
3300008497Human stool microbial communities from NIH, USA - visit 1, subject 404239096 reassemblyHost-AssociatedOpen in IMG/M
3300008672Human stool microbial communities from NIH, USA - visit 2, subject 764487809 reassemblyHost-AssociatedOpen in IMG/M
3300008726Human stool microbial communities from NIH, USA - visit 1, subject 764669880 reassemblyHost-AssociatedOpen in IMG/M
3300008750Human stool microbial communities from NIH, USA - visit 2, subject 159005010 reassemblyHost-AssociatedOpen in IMG/M
3300010262Eastern black-and-white colobus group fecal microbial communities from Wisconsin, USA - Cm1105 metagenomeHost-AssociatedOpen in IMG/M
3300010280Ring-tailed lemur group fecal microbial communities from Wisconsin, USA - L827 metagenomeHost-AssociatedOpen in IMG/M
3300013752Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 288Host-AssociatedOpen in IMG/M
3300013899Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 294Host-AssociatedOpen in IMG/M
3300013942Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 150Host-AssociatedOpen in IMG/M
3300014530Human fecal microbial communities from infant at 4 months in Denmark - 511_4MHost-AssociatedOpen in IMG/M
3300014536Human fecal microbial communities from obese patients in Germany - AS58_12Host-AssociatedOpen in IMG/M
3300014538Human fecal microbial communities from obese patients in Germany - AS60_6Host-AssociatedOpen in IMG/M
3300014547Human fecal microbial communities from obese patients in Germany - AS65_18Host-AssociatedOpen in IMG/M
3300014560Human fecal microbial communities from obese patients in Germany - AS51_12Host-AssociatedOpen in IMG/M
3300014561Human fecal microbial communities from obese patients in Germany - AS64_24Host-AssociatedOpen in IMG/M
3300014566Human fecal microbial communities from obese patients in Germany - AS58_18Host-AssociatedOpen in IMG/M
3300014572Human fecal microbial communities from obese patients in Germany - AS65_6Host-AssociatedOpen in IMG/M
3300014782Human fecal microbial communities from obese patients in Germany - AS68_0Host-AssociatedOpen in IMG/M
3300014797Human fecal microbial communities from obese patients in Germany - AS64_18Host-AssociatedOpen in IMG/M
3300014803Human fecal microbial communities from obese patients in Germany - AS68_24Host-AssociatedOpen in IMG/M
3300014941Human fecal microbial communities from obese patients in Germany - AS63_0Host-AssociatedOpen in IMG/M
3300014963Human fecal microbial communities from elderly subjects during probiotic consumption in Boston, USA - meta_42827d56Host-AssociatedOpen in IMG/M
3300023484Human gut microbial communities from healthy child feces in Northridge, California, USA - CDI_75CHost-AssociatedOpen in IMG/M
3300023498Human gut microbial communities from healthy child feces in Northridge, California, USA - CDI_30AHost-AssociatedOpen in IMG/M
3300023720Human gut microbial communities from healthy child feces in Northridge, California, USA - CDI_50BHost-AssociatedOpen in IMG/M
3300029028Human fecal microbial communities from infant at 12 months in Denmark - 350_12MHost-AssociatedOpen in IMG/M
3300029030Human fecal microbial communities from mother in Denmark - 367_MHost-AssociatedOpen in IMG/M
3300029043Human fecal microbial communities from mother in Denmark - 26_MHost-AssociatedOpen in IMG/M
3300029059Human fecal microbial communities from mother in Denmark - 338_MHost-AssociatedOpen in IMG/M
3300029099Human fecal microbial communities from infant at 12 months in Denmark - 128_12MHost-AssociatedOpen in IMG/M
3300029115Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI021299-74Host-AssociatedOpen in IMG/M
3300029132Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI019854-111Host-AssociatedOpen in IMG/M
3300029133Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI019845-88Host-AssociatedOpen in IMG/M
3300029211Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI011684-90Host-AssociatedOpen in IMG/M
3300029227Human fecal microbial communities from Rheumatoid Arthritis patients in China - RSZAXPI002670-43Host-AssociatedOpen in IMG/M
3300029249Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI011676-93Host-AssociatedOpen in IMG/M
3300029254Human fecal microbial communities from Rheumatoid Arthritis patients in China - SZAXPI011697-35Host-AssociatedOpen in IMG/M
3300029348Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 044_10_29_stool_2Host-AssociatedOpen in IMG/M
3300029357Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 050_3_9_stool_1Host-AssociatedOpen in IMG/M
3300029358Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 046_3_12_stool_2Host-AssociatedOpen in IMG/M
3300029362Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 053_3_13_stool_1Host-AssociatedOpen in IMG/M
3300029387Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 094_5_2_stool_1Host-AssociatedOpen in IMG/M
3300029417Human fecal microbial communities from liver cirrhosis patients in Hangzhou, China - LD-84_Run4Host-AssociatedOpen in IMG/M
3300029433Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 037_10_30_stool_1Host-AssociatedOpen in IMG/M
3300029465Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001876-23Host-AssociatedOpen in IMG/M
3300029484Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001871-18Host-AssociatedOpen in IMG/M
3300029490Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI001929-16Host-AssociatedOpen in IMG/M
3300029513Human fecal microbial communities from Shanghai Jiao Tong University, China - RSZAXPI005377-43Host-AssociatedOpen in IMG/M
3300029530Human fecal microbial communities from Shanghai, China - P057V6Host-AssociatedOpen in IMG/M
3300029549Human fecal microbial communities from Shanghai, China - P017V6Host-AssociatedOpen in IMG/M
3300029565Human fecal microbial communities from Shanghai Jiao Tong University, China - SZAXPI022006-90Host-AssociatedOpen in IMG/M
3300029575Human fecal microbial communities from Shanghai, China - P023V1Host-AssociatedOpen in IMG/M
3300029584Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35583Host-AssociatedOpen in IMG/M
3300029607Human fecal microbial communities from Shanghai, China - P025V1Host-AssociatedOpen in IMG/M
3300029610Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35992Host-AssociatedOpen in IMG/M
3300029617Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35739Host-AssociatedOpen in IMG/M
3300029653Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_35653Host-AssociatedOpen in IMG/M
3300029686Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37305R1Host-AssociatedOpen in IMG/M
3300029696Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37276Host-AssociatedOpen in IMG/M
3300029709Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37173Host-AssociatedOpen in IMG/M
3300029714Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_36525Host-AssociatedOpen in IMG/M
3300029716Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37228Host-AssociatedOpen in IMG/M
3300029737Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37286Host-AssociatedOpen in IMG/M
3300029783Human fecal microbial communities from healthy subjects in Hangzhou, China - HD-60_Run5Host-AssociatedOpen in IMG/M
3300029789Human feces microbial communities from a cholera patient in hospital, Baltimore, Maryland, USA - 026_10_28_stool_2Host-AssociatedOpen in IMG/M
3300029830Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_36034Host-AssociatedOpen in IMG/M
3300029854Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37268R1Host-AssociatedOpen in IMG/M
3300029856Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37285Host-AssociatedOpen in IMG/M
3300029861Human fecal microbial communities from twins in the TwinsUK registry in London, United Kingdom - YSZC12003_37399Host-AssociatedOpen in IMG/M
7000000036Human stool microbial communities from NIH, USA - visit 2 of subject 765074482 replicate 2Host-AssociatedOpen in IMG/M
7000000171Human stool microbial communities from NIH, USA - visit 1, subject 706846339Host-AssociatedOpen in IMG/M
7000000186Human stool microbial communities from NIH, USA - visit 1, subject 809635352Host-AssociatedOpen in IMG/M
7000000187Human stool microbial communities from the National Institute of Health, USA - subject 158499257, visit 2Host-AssociatedOpen in IMG/M
7000000265Human stool microbial communities from NIH, USA - visit 2, subject 158256496Host-AssociatedOpen in IMG/M
7000000401Human stool microbial communities from NIH, USA - visit 1, subject 158802708Host-AssociatedOpen in IMG/M
7000000429Human stool microbial communities from NIH, USA - visit 2, subject 604812005Host-AssociatedOpen in IMG/M
7000000475Human stool microbial communities from NIH, USA - visit 1, subject 160704339Host-AssociatedOpen in IMG/M
7000000579Human stool microbial communities from NIH, USA - visit 1, subject 159551223Host-AssociatedOpen in IMG/M
7000000630Human stool microbial communities from NIH, USA - visit number 3 of subject 763536994Host-AssociatedOpen in IMG/M
7000000659Human stool microbial communities from NIH, USA - visit 2, subject 764002286Host-AssociatedOpen in IMG/M
7000000684Human stool microbial communities from NIH, USA - visit 2, subject 763597684Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
MHC6B_contig02440_metagene_gene_42051223007Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLSRLFSARRQIRLCAPDLKRRNETRRHPMPVLKLY
bke_il_velvet_000529702065487000Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY
STU_0643.000009402149837021Human FecalGTNGEEGFRHHISEELKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY
STU_0698.000036802149837021Human FecalGTNGEEGFRHHISEELKKTIPGRALDNLFYLQYDLPPEASFHATTEEAKRPDELYIRKLLPELTRLKLQPCHVVANDEAYYAAMKGISLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNEAKRPPKPALKFY
STU_0924.000006002149837022Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNETRRDPMPVLKLY
EM039_100607263300000273Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY*
EM219_103399073300000279Human FecalISEELKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY*
EM227_101669623300000281Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKRRNETRRHPMPVLKLY*
EM268_100845863300000286Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELIRLKLQPRHVVANDEAYYAVMKGVSLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY*
EM305_100467453300000292Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTHLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKRRNETRRHPMPVLKLY*
EM203_100587633300000331Human FecalLKKTTPGRALENLFYLQYDLPPEVSFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTKDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY*
EM177_1002021123300000357Human FecalLKKTIPGQSLENLFYLQYDLPPEASFHATTEEAKRPDELYMQKLLPELNRLGLQPRHIVANDEAYYAVMKGVTLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNEVKRPPRSVLKFY*
Ga0100256_10689133300006487HumanLKKTIPGRALDNLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGISLFTSEAEKLMHRADYYSARRQIRLCAPDLKRRNEAKRPPTPALKFY*
Ga0101027_12417843300006525HumanRFAVGTNGEEGFRHHISEELKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY*
Ga0100215_101511153300006568HumanLKKTIPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKRRNETRRHPMPVLKLY*
Ga0100215_13293913300006568HumanHAVRFAVGTNGEEGFRHHISEELKKTIPGRALDNLFYLQYDLPPEASFHATTEEAKRPDELYIRKLLPELTRLKLQPCHVVANDEAYYAAMKGISLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNEAKRPPKPALKFY*
Ga0101801_100646293300006747HumanLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYLRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY*
Ga0102536_100052953300007043HumanMIPGRALDNLFYLQYDLPPEASFHATTEEAKRPDELYIRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKRRNETRRHPMPVLKLY*
Ga0102634_12072333300007111HumanGVAVGTNGEEGFRHHISEELKKTIPGRALDNLFYLQYDLPPEASFHATTEEAKRPDELYIRKLLPELTRLKLQPCHVVANDEAYYAAMKGISLFTPEAEKLMHRADYYSARRPLRPWXXXXIRLCAPDLKRRNEAKRPPKPALKFY*
Ga0104838_13361923300007298HumanEASFHATTEEAKRPDELYMRKLLPELIRLKLQPRHIVANDEAYYAAMKGVMLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNEVKRPPRPALKFY*
Ga0104766_1000564123300007360HumanLKKTIPGQSLENLFYLQYDLPSEASFHATTEEAKRPDELYMQKLLPELNRLGLQPRHIVANDEAYYAMMKGVTLFTSEAEKLMLTEDYFSARRQIRLCAPDLKRRNEAKRPPKPVLKFY*
Ga0104788_10313553300007362HumanLKKTIPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY*
Ga0104842_100330163300007530HumanLKKTTPGRALENLFYLQYDLPPEASFHATTEETKRPDELYLRKLLPELTRLKLQPRHVVANDEAYYAAMKGVMLFTPEAEKLMLAEDYFSARRQIRLCAPDLKRLNETRRHPMPVLKLY*
Ga0105527_11922013300007641HumanLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKRRNETRR
Ga0105532_10181633300007650HumanLKKTIPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEVYYAAMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRYPMPVLKLY*
Ga0105536_10983233300007657HumanLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELIRLKLQPRHIVANDEAYYAAMKGVMLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNEVKRPPRPALKFY*
Ga0105536_13679413300007657HumanLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKRRNETRRHPMPVLKLY*
Ga0105636_10487623300007705HumanLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLILTEDYFSVRRQIRLCAPDLKRRNETRRHPMPVLKLY*
Ga0105637_102215113300007805HumanEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY*
Ga0111562_101288123300007921HumanLKKTTPGRALENLLYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEVYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY*
Ga0113559_13796323300008081HumanHAVRFAVGTNGEEGFRHHISEELKKTIPGRALDNLFYLQYDLPPEASFHATTEEAKRPDELYIRKLLPELTRLKLQPCHVVANDEAYYAAMKGISLFTPEAEKLMHRADYYSAQRDTPGXXXXKSGCVHRI*
Ga0111491_102869913300008268HumanLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGVTLFTPEAEKLMLTEDYFSARRQIRLCA
Ga0114156_100391233300008282HumanLKKTIPGRALDNLFYLQYDLPPEASFHATTEEAKRPDELYIRKLLPELTRLKLQPCHVVANDEAYYAAMKGISLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNEAKRPPKPALKFY*
Ga0115311_101253143300008326HumanLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNETRRDPMPVLKLY*
Ga0114873_100397303300008385HumanLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGVMLFTPEAEKLMLAEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY*
Ga0111011_10041573300008497HumanLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKRRNETRRDPMPVLKLY*
Ga0111519_100481493300008672HumanLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTHLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKRRNETRWHPMPVLKLY*
Ga0113881_10107883300008726HumanLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRLNETRRHPMPVLKLY*
Ga0114087_11752533300008750HumanENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELIRLKLQPRHIVANDEAYYAAMKGVMLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNEVKRPPRPALKFY*
Ga0129317_102565923300010262Eastern Black-And-White Colobus Group FecalLKKTIPGRALDNLFYLQYDLPPEASFHATTEEAKRPDELYIRKLLPELTRLKLQPCHVVANDEAYYAAMKGISLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNEAKRPPKP
Ga0129308_101672833300010280Ring-Tailed Lemur Group FecalLKKTIPGRALDNLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGISLFTSEAEKLMHRADYYSARRQIRLCAPDLKRRNEVKRPPKPALKFY*
Ga0117817_100328533300013752Human GutLKKTTPGRALENLFYLQYDLPPEASFHATTEETKRPDELYLRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRLNETRRHPMPVLKLY*
Ga0117808_11200633300013899Human GutLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELIRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY*
Ga0117795_100301433300013942Human GutLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKRRNEAKRPPKPALKFY*
Ga0169724_10069773300014530Human Host-AssociatedLKKTTPGRALENLLYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY*
Ga0134370_10855843300014536Human FecalSFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY*
Ga0134452_10266553300014538Human FecalLKKTIPGRALDNLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGISLFTSEAEKLMLAEDYFSARRQIRLCAPDLKRLNETRRHPMPVLKLY*
Ga0134415_10169943300014547Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGVTLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNEVKRPPRPALKFY*
Ga0134394_10176463300014560Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLXXXXXXXXXXDLKRRNETRRHPMPVLKLY*
Ga0134428_10050863300014561Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGVMLFTPEAEKLMLAEDYFSARRQIRLCAPDLKRLNETRRHPMPVLKLY*
Ga0134372_100266443300014566Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLD*
Ga0134457_100074233300014572Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGVTLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY*
Ga0134389_100156243300014782Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEETKRPDELYLRKLLPELTRLKLQPRHVVANDEAYYAAMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRLNETRRHPMPVLKLY*
Ga0134414_100255833300014797Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPCHVVANDEAYYAAMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY*
Ga0134430_100355023300014803Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEETKRPDELYLRKLLPELTRLKLQPCHVVANDEAYYAAMKGISLFTPEAEKLMHRADYYSARRQIRLI*
Ga0134385_10432233300014941Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNETRRHPMPVLKLY*
Ga0134523_1004220143300014963Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKL*
Ga0257055_10856103300023484Human GutLKKTTPGRALENLFYLQYDLPPEASFHATTEETKRPDELYLRKLLPELTRLKLQPRHVVANDEAYYAAMKGVMLFTPEAEKLMLAEDYFSARRQIRLCAPDLKRLNETRRHPMPVLKLY
Ga0257046_10610363300023498Human GutLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKRRNETRRHPMPVLKLY
Ga0257049_101397153300023720Human GutLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNETRRHPMPVLKLY
Ga0169666_10164053300029028Human Host-AssociatedLKKTIPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEVYYAAMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRYPMPVLKLY
Ga0169673_10135733300029030Human Host-AssociatedLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKRRNEAKRPPKPALKFY
Ga0169613_100124333300029043Human Host-AssociatedLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLILTEDYFSVRRQIRLCAPDLKRRNETRRHPMPVLKLY
Ga0169653_10658573300029059Human Host-AssociatedHAVRFAVGTNGEEGFRHHISEELKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTHLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKRRNETRRHPMPVLKLY
Ga0169186_11251433300029099Human Host-AssociatedLKKTTPGRALENLFYLQYDLPPEASFHATTEETKRPDELYLRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNEAKRPPKPALKFY
Ga0168848_12254133300029115Host-AssociatedLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTKDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY
Ga0168796_13716923300029132Host-AssociatedLKKTIPGRALDNLFYLQYDLPPEASFHATTEEAKRPDELYIRKLLPELTRLKLQPCHVVANDEAYYAAMKGISLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNEAKRPPKPALKFY
Ga0168787_10203083300029133Host-AssociatedLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKRLNETRRHPMPVLKLY
Ga0168693_11359943300029211Host-AssociatedALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY
Ga0168687_100100333300029227Host-AssociatedLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGVMLFTPEAEKLMLAEDYFSARRQIRLCAPDLKRLNETRRHPMPVLKLY
Ga0168690_100816323300029249Host-AssociatedLKKTTPGRALENLFYLQYDLPPEASFHATTEETKRPDELYLRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNETRRHPMPVLKLY
Ga0168700_1000497403300029254Host-AssociatedLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTLEAEKLMLTEDYFSVRRQIRLCAPDLKRRNETRRHPMPVLKLY
Ga0243800_10759323300029348Human FecesLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTHLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKRRNETRRHPMPVLKLY
Ga0243847_101197273300029357Human FecesLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTLEAEKLMLTEDYFSVRRQIRLCAPDLKRRNETRRDPMPVLKLY
Ga0243818_102281713300029358Human FecesYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY
Ga0243852_106163913300029362Human FecesTLHAVRFAVGTNGEEGFRHHISEELKKTIPGRALDNLFYLQYDLPPEASFHATTEEAKRPDELYIRKLLPELTRLKLQPCHVVANDEAYYAAMKGISLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNEAKRPPKPALKFY
Ga0243994_13425013300029387Human FecesLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKR
Ga0243409_101077163300029417Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGVTLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNEVKRPPRPVLKFY
Ga0243761_101887813300029433Human FecesENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY
Ga0244121_100077123300029465Human FecalLKKTIPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGVTLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNEVKRPPRPALKFY
Ga0244116_10679143300029484Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRLNETRRHPMPVLKLY
Ga0244116_13278313300029484Human FecalVGTNGEEGFRHHISEELKKTIPGRALDNLFYLQYDLPPEASFHATTEEAKRPDELYIRKLLPELTRLKLQPCHVVANDEAYYAAMKGISLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNEAKRPPKPALKFY
Ga0244171_100262223300029490Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELIRLKLQPRHVVANDEAYYAVMKGVSLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY
Ga0244810_12946413300029513Human FecalALENLFYLQYDLPPEASFHATTEEAKRPDELYIRKLLPELTRLKLQPCHVVANDEAYYAAMKGISLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNEAKRPPKPALKFY
Ga0244962_12387813300029530Human FecalFRHHISEELKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY
Ga0244894_11935423300029549Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLXXXXFSVRRQIRLCAPDLKRRNEAKRPPKPALKFY
Ga0244861_10263083300029565Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLAEDYFSARRQIRLCAPDLKRLNETRRHPMPVLKLY
Ga0244903_1000083493300029575Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELIRLKLQPRHIVANDEAYYAAMKGVMLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNEVKRPPRPALKFY
Ga0244903_13136713300029575Human FecalLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKRRNETRRHPMPVLKLY
Ga0245112_12088823300029584Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGVTLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNEVKRPPRPALKFY
Ga0244907_11784223300029607Human FecalLKKTTPGRALENLFYLQYDLPPEVSFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLILTEDYFSVRRQIRLCAPDLKRRNETRRHPMPVLKLY
Ga0245132_10778053300029610Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGVTLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNEVKRPLRPALKFY
Ga0245125_101722113300029617Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKRRNETRXXXXXXXCLNYTKY
Ga0245224_100153773300029653Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRLDELYMRKLLPELTHLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKRRNETRRHPMPVLKLY
Ga0245204_12210713300029686Human FecalFRHHISEELKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELIRLKLQPRHIVANDEAYYAAMKGVMLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNEVKRPPRPALKFY
Ga0245263_12004723300029696Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHIVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKRRNETRRHPMPVLKLY
Ga0245177_10015583300029709Human FecalLKKTTPGRALENLFYLQYDLPPEVSFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTKDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY
Ga0245242_1000110353300029714Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEETKRPDELYLRKLLPELTRLKLQPRHVVANDEAYYAAMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY
Ga0245260_100279353300029716Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRXXXXXAVCTGFETTK
Ga0245199_100279323300029737Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLYAPDLKRLNETRRHPMPVLKLY
Ga0243236_103056523300029783Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTLEAEKLMLTEDYFSARRQIRLC
Ga0243734_102345113300029789Human FecesHISEELKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKRRNETRRHPMPVLKLY
Ga0245137_13873323300029830Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELIRLKLQPRHIVANDEAYYAAMKGVMLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNEAKRPPKPALKFY
Ga0245294_10390123300029854Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEETKRPDELYLRKLLPELTRLKLQPRHVVANDEAYYAAMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNEAKRPPKPALKFY
Ga0245296_101295153300029856Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNEVKRPPRPALKFY
Ga0245310_10182283300029861Human FecalLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELIRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY
SRS049164_WUGC_scaffold_84180__gene_1457407000000036HumanLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCA
SRS052697_LANL_scaffold_49554__gene_940827000000171HumanLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKRRNETRRDPMPVLKLY
SRS022524_Baylor_scaffold_43724__gene_1024257000000186HumanLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGVMLFTPEAEKLMLAEDYFSARRQIRLCAPDLKRLNETRRHPM
SRS022609_Baylor_scaffold_67467__gene_1107117000000187HumanLKKTIPGQSLENLFYLQYDLPSEASFHATTEEAKRPDELYMQKLLPELNRLGLQPRHIVANDEAYYAMMKGVTLFTSEAEKLMLTEDYFSARRQIRLCAPDLKRRNEAKRPPKPVLKFY
SRS021948_Baylor_scaffold_4806__gene_66417000000265HumanLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELIRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSVRRQIRLCAPDLKR
C3052597__gene_1928927000000401HumanLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRN
C2066859__gene_1874467000000429HumanLKKTIPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEVYYAAMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKR
SRS020328_Baylor_scaffold_3459__gene_92087000000475HumanLKKTTPGRALENLLYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEVYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY
C2659695__gene_1822097000000579HumanQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY
SRS062427_LANL_scaffold_6062__gene_164167000000630HumanLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYLRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMLTEDYFSARRQIRLCAPDLKRRNETRRHPMPVLKLY
SRS015854_WUGC_scaffold_23528__gene_384537000000659HumanVRFAVGTNGEEGFRHHISEELKKTIPGRALDNLFYLQYDLPPEASFHATTEEAKRPDELYIRKLLPELTRLKLQPCHVVANDEAYYAAMKGISLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNEAKRPPKPALKFY
SRS019582_WUGC_scaffold_10954__gene_98787000000684HumanLKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPCHVVANDEAYYAAMKGISLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNEAKRPPKPALKFY

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.