NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300014538

3300014538: Human fecal microbial communities from obese patients in Germany - AS60_6



Overview

Basic Information
IMG/M Taxon OID3300014538 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0121297 | Gp0151624 | Ga0134452
Sample NameHuman fecal microbial communities from obese patients in Germany - AS60_6
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Hohenheim
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size87641835
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes timonensis1
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Fecal Microbial Communities From Obese Patients In Germany
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Obese Patients In Germany

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationGermany
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F076064Metagenome118N
F076190Metagenome118Y
F105374Metagenome100N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0134452_102665All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes3225Open in IMG/M
Ga0134452_104167All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes timonensis2144Open in IMG/M
Ga0134452_113143All Organisms → cellular organisms → Bacteria773Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0134452_102665Ga0134452_1026655F076064LKKTIPGRALDNLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGISLFTSEAEKLMLAEDYFSARRQIRLCAPDLKRLNETRRHPMPVLKLY*
Ga0134452_104167Ga0134452_1041673F105374GFGYYFCTFRLILRPGFGAAENIRYLVLSKGVFAMKKRVALLVALCIWKVVAAQTPYGEMPERFRPDTLPCRLGGGVCFGMDGLDAAIPRGEGASSCRDPRVVFVAGDTLITFISVAGVANTALGDPVCRFYGRNVARVVSRTRRMTGGRMGAADNDFPDDPDFAELQGVVIENQRYPWESYAAGDSAYRLPVARSLVGGKEDPLLGSDMRRRYVRLLTEVSVELKAGGTRPFVHVVYLLPDP*
Ga0134452_113143Ga0134452_1131431F076190SRVSGRVWSLVRITVPNGLKSVKIGVEKPQNNTLYSYFQRELL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.