NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300010280

3300010280: Ring-tailed lemur group fecal microbial communities from Wisconsin, USA - L827 metagenome



Overview

Basic Information
IMG/M Taxon OID3300010280 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0120398 | Gp0147144 | Ga0129308
Sample NameRing-tailed lemur group fecal microbial communities from Wisconsin, USA - L827 metagenome
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size294047809
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Predicted Viral1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes senegalensis1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. CAG:74_58_1201

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameAnimal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa
TypeHost-Associated
TaxonomyHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Ring-Tailed Lemur Group Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationUSA: Wisconsin
CoordinatesLat. (o)43.07Long. (o)-89.4Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061388Metagenome132N
F076064Metagenome118N
F099451Metagenome103N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0129308_1014432All Organisms → Viruses → Predicted Viral2419Open in IMG/M
Ga0129308_1016728All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes senegalensis2107Open in IMG/M
Ga0129308_1045579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → unclassified Faecalibacterium → Faecalibacterium sp. CAG:74_58_120910Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0129308_1014432Ga0129308_10144323F099451VNNGCAPENTLRGFKLAKIMRIDKIKTVGQLRKVIENLSDDYEIEMRIRRKLTDEDIIKLHKKYGKIYPYPYETSYSELEFDDVGVSDKVLCLGVELKE*
Ga0129308_1016728Ga0129308_10167283F076064LKKTIPGRALDNLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAAMKGISLFTSEAEKLMHRADYYSARRQIRLCAPDLKRRNEVKRPPKPALKFY*
Ga0129308_1045579Ga0129308_10455793F061388YATQFRATALPRNERGAYYSPRDDSVHLSIHSVAQGDSISTPYSVLFHEYGHMTDYLIARGEGRSRYSAYSDLFQGIGADGKPILRRSSSGGLLGRTAKDELEGHLSRIRSRNPSMTRDQAARRLVSEAMGKYSVRDRSDISDMFEGAGIGIPYPLGSGHGLDYWSARGNGKEIFAEIVSAEAAHPGSLKAIKEYFPKTYQVYQDMVKARKKK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.