 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300023720 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0133482 | Gp0296401 | Ga0257049 |
| Sample Name | Human gut microbial communities from healthy child feces in Northridge, California, USA - CDI_50B |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of California, Irvine |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 109935000 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 4 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Enterocloster → Enterocloster citroniae | 1 |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium merycicum | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Child Gut Microbiome |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut → Child Gut Microbiome |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal distal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | USA: Northridge, California | |||||||
| Coordinates | Lat. (o) | 34.2381 | Long. (o) | -118.5301 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F076064 | Metagenome | 118 | N |
| F083452 | Metagenome | 113 | N |
| F088920 | Metagenome | 109 | Y |
| F090515 | Metagenome | 108 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0257049_100165 | Not Available | 85633 | Open in IMG/M |
| Ga0257049_100903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Lachnospiraceae → Enterocloster → Enterocloster citroniae | 25440 | Open in IMG/M |
| Ga0257049_101397 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Rikenellaceae → Alistipes → Alistipes onderdonkii | 16690 | Open in IMG/M |
| Ga0257049_107658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Bifidobacteriales → Bifidobacteriaceae → Bifidobacterium → Bifidobacterium merycicum | 2606 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0257049_100165 | Ga0257049_10016583 | F083452 | MSGRVKIKSKDKDKKPKIDVFKVIESRFKNMNELRDLIDTDPRKGLVRIRDGAGFREVERGGCLHQNYLNLLEEELGTKLSIDLMDKYIKRNI |
| Ga0257049_100903 | Ga0257049_1009032 | F090515 | LQGTAPGRVACLEFAGGEKRKTNIAADYAVKALAFTALLCRHIGSIRTFLKS |
| Ga0257049_101397 | Ga0257049_10139715 | F076064 | LKKTTPGRALENLFYLQYDLPPEASFHATTEEAKRPDELYMRKLLPELTRLKLQPRHVVANDEAYYAVMKGVMLFTPEAEKLMHRADYYSARRQIRLCAPDLKRRNETRRHPMPVLKLY |
| Ga0257049_107658 | Ga0257049_1076582 | F088920 | LFVKWNPKNHYFIFLFLAFFSFVSANLHHYPAFWAGFILHLILHFSQKAVIFAPKRAILLLFVPTLFFGCEAVLSLHTSSKISGQTSLY |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |