NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold RmDRAFT_ConsensusfromContig1229778

Scaffold RmDRAFT_ConsensusfromContig1229778


Overview

Basic Information
Taxon OID2075704000 Open in IMG/M
Scaffold IDRmDRAFT_ConsensusfromContig1229778 Open in IMG/M
Source Dataset NameBovine rumen microbial communities from Vernon, TX, USA, Sample 511
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterTexas A and M University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)639
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Bovine Rumen → Bovine Rumen Microbial Communities From Vernon, Tx, Usa

Source Dataset Sampling Location
Location NameVernon, Texas
CoordinatesLat. (o)34.154Long. (o)-99.264Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059440Metagenome / Metatranscriptome134Y

Sequences

Protein IDFamilyRBSSequence
RmDRAFT_09015000F059440N/AMGKTRLEREAEFKAKIAELDEYVKKMNAKSNKTDEEVDEVISAMQLTNKYLRAIGASEEEMYDI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.