Basic Information | |
---|---|
Taxon OID | 2081372005 Open in IMG/M |
Scaffold ID | SRM_contig48605 Open in IMG/M |
Source Dataset Name | Rangifer tarandus platyrhynchus rumen microbial communities from Svalbard, Norway - Sample 549 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Macrogen |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 571 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rangifer Tarandus Platyrhynchus Rumen → Rangifer Tarandus Platyrhynchus Rumen Microbial Communities From Svalbard, Norway |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Longyearbyen, Svalbard | |||||||
Coordinates | Lat. (o) | 78.2166667 | Long. (o) | 15.6333333 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F093041 | Metagenome / Metatranscriptome | 106 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
SRM_00400330 | F093041 | GGAGG | MIIDGEKPKSFSPRALLRSKTARLFCHILIAMSIGRMIQRIIRCQTCRLAAKSIESSIDFAIR |
⦗Top⦘ |