NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SRM_contig48605

Scaffold SRM_contig48605


Overview

Basic Information
Taxon OID2081372005 Open in IMG/M
Scaffold IDSRM_contig48605 Open in IMG/M
Source Dataset NameRangifer tarandus platyrhynchus rumen microbial communities from Svalbard, Norway - Sample 549
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMacrogen
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)571
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rangifer Tarandus Platyrhynchus Rumen → Rangifer Tarandus Platyrhynchus Rumen Microbial Communities From Svalbard, Norway

Source Dataset Sampling Location
Location NameLongyearbyen, Svalbard
CoordinatesLat. (o)78.2166667Long. (o)15.6333333Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F093041Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
SRM_00400330F093041GGAGGMIIDGEKPKSFSPRALLRSKTARLFCHILIAMSIGRMIQRIIRCQTCRLAAKSIESSIDFAIR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.