Scaffold STU__NODE_2197_len_11329_cov_12_405419

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold STU__NODE_2197_len_11329_cov_12_405419

Scaffold STU__NODE_2197_len_11329_cov_12_405419

Overview

Basic Information
Taxon OID	2149837016 Open in IMG/M
Scaffold ID	STU__NODE_2197_len_11329_cov_12_405419 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from the University of Arizona (HMP) - Ef2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Chinese National Human Genome Center, Beijing
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	11357
Total Scaffold Genes	27 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	15 (55.56%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From The University Of Arizona, For Hmp Training

Source Dataset Sampling Location
Location Name	Bording, Denmark
Coordinates	Lat. (^o)	56.13	Long. (^o)	9.24	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076653	Metagenome	118	N

Sequences

Protein ID	Family	RBS	Sequence
STU_0901.00000410	F076653	N/A	MTRNRLMTIRDKYFGWKDIFFDRFVHCCNEKSDQPQGSNIPLAKINFDNKTGYVEDGTINIAELLQYLWINNKVYGCEYAPIDIPSVLQTLIRLTENAKHMFEDQPGVYDMIPYRGFFLRDDFLSGKDYSLDLDKIVSGMGGWYGEDEDPCYSMFVSQDQIWNLNPILKVLADEGSILAKELGYDMNSYVSDNGYTIYNPYLSWINHYYHYCPTFNEDKLKPWDRVEDRKNKFKMTDKVKRGANNWYYSGGTISCVDSFLGKKYRKNLRTFIYRGIVFFLDRIWHTSLFDRMGVKMKYNAYYCYAATSGIWYDKGFKRRLAKRFNRSLSGGGELFGANLACMVCDRKDIDWEALRFWLEKYDDPTDKGMVNSPIQFMYLYLYYTFNK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.