NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold TCCM__contig04018

Scaffold TCCM__contig04018


Overview

Basic Information
Taxon OID2156126005 Open in IMG/M
Scaffold IDTCCM__contig04018 Open in IMG/M
Source Dataset NameMarine Trichodesmium cyanobacterial communities from the Bermuda Atlantic Time-Series
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)961
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Trichodesmium Cyanobacterial Communities From The Bermuda Atlantic Time-Series

Source Dataset Sampling Location
Location NameAtlantic Ocean
CoordinatesLat. (o)25.5Long. (o)-67.3Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047103Metagenome / Metatranscriptome150Y

Sequences

Protein IDFamilyRBSSequence
TCCM_0018.00000590F047103N/AMHILDQIWPFLGPKILIFMGVSKSFGTNITENHFGNLSALFFGQALDQMGQKCRYLAQNASFGPNLAVFGPKIQFFGGRE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.