Basic Information | |
---|---|
Taxon OID | 2156126005 Open in IMG/M |
Scaffold ID | TCCM__contig04349 Open in IMG/M |
Source Dataset Name | Marine Trichodesmium cyanobacterial communities from the Bermuda Atlantic Time-Series |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 912 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota | (Source: Euk_MAG) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Trichodesmium Cyanobacterial Communities From The Bermuda Atlantic Time-Series |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 25.5 | Long. (o) | -67.3 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F032301 | Metagenome / Metatranscriptome | 180 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
TCCM_0349.00000250 | F032301 | GGA | VASKLSPQQADGFFYQSDMKIREKGKFFVNRSVPENFQWENFLGQVPTESLRTQDSENVYERWVQQIFDPVLPARSWEMPVKCELPAKIGRCCNRRYGHTFQNSA |
⦗Top⦘ |