Scaffold TCCM__contig06489

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold TCCM__contig06489

Scaffold TCCM__contig06489

Overview

Basic Information
Taxon OID	2156126005 Open in IMG/M
Scaffold ID	TCCM__contig06489 Open in IMG/M
Source Dataset Name	Marine Trichodesmium cyanobacterial communities from the Bermuda Atlantic Time-Series
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	684
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota	(Source: Euk_MAG)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Trichodesmium Cyanobacterial Communities From The Bermuda Atlantic Time-Series

Source Dataset Sampling Location
Location Name	Atlantic Ocean
Coordinates	Lat. (^o)	25.5	Long. (^o)	-67.3	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059484	Metagenome / Metatranscriptome	134	N

Sequences

Protein ID	Family	RBS	Sequence
TCCM_0489.00000460	F059484	GGA	VASKLWVHEPDTFFLEAAREISEKWNFFVNRSVPENFGRENFSGQVPTESLRTQDSEYVYERWVQQIFDHVLVARSWVSAKKWGPLAKLLGVTKKCISQNLRI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.