NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GG70X8M02HCC7S

Scaffold GG70X8M02HCC7S


Overview

Basic Information
Taxon OID2189573024 Open in IMG/M
Scaffold IDGG70X8M02HCC7S Open in IMG/M
Source Dataset NameEcho Passage metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterArizona Genomics Institute
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)514
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Speleothem And Rock Wall Surfaces → Speleothem And Rock Wall Surfaces Microbial Communities From Kartchner Caverns, Benson, Arizona, Usa

Source Dataset Sampling Location
Location NameKartchner Caverns, Benson, Arizona, USA
CoordinatesLat. (o)31.837801Long. (o)-110.350292Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019464Metagenome229Y

Sequences

Protein IDFamilyRBSSequence
KCEPM_01885330F019464N/AMAAFLRVLGIVVVATGLGTAAAAGWLLAGDAHFREVSAAYARHPEHALFQAEYVAAAARHYGLLAGVVGGLLGGLALGGMLLALGELLRRIPRG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.