Scaffold SS33_p0279325

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SS33_p0279325

Scaffold SS33_p0279325

Overview

Basic Information
Taxon OID	2236876018 Open in IMG/M
Scaffold ID	SS33_p0279325 Open in IMG/M
Source Dataset Name	Saline water concentrator pond microbial communities from Bras del Port saltern, Spain - SS33
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	GATC-Biotech AG, Konstanz, Germany
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	542
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → unclassified bacterial viruses → environmental samples → environmental Halophage eHP-30	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water Concentrator Pond → Saline Water Concentrator Pond Microbial Communities From Bras Del Port Saltern, Santa Pola, Spain

Source Dataset Sampling Location
Location Name	Spain: Bras del Port
Coordinates	Lat. (^o)	38.11	Long. (^o)	-0.36	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062484	Metagenome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
SS33_02793252	F062484	N/A	MWLIGSKTDIETYIAKVDKAEGFTGNLTKSWAEPRKHPDKDLYACPKNESVEPDSQLTEKEELPED

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.