NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SS37_p0049369

Scaffold SS37_p0049369


Overview

Basic Information
Taxon OID2236876021 Open in IMG/M
Scaffold IDSS37_p0049369 Open in IMG/M
Source Dataset NameSaline water concentrator pond microbial communities from Bras del Port saltern, Spain - SS37
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGATC-Biotech AG, Konstanz, Germany
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)507
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Salt Crystallizer Ponds → Unclassified → Saline Water Concentrator Pond → Saline Water Concentrator Pond Microbial Communities From Bras Del Port Saltern, Santa Pola, Spain

Source Dataset Sampling Location
Location NameBras del Port Saltern, Santa Pola, Spain
CoordinatesLat. (o)38.11Long. (o)-0.36Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F088354Metagenome109Y

Sequences

Protein IDFamilyRBSSequence
SS37_00493693F088354N/ANDNAKTNPTKPMTDTPRTQLDVDRFETAVVNANGQVYLGRDLEGAKVHVAVEIVEDADEQEDPDQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.