 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300000114 Open in IMG/M |
| Scaffold ID | IMNBL3_c10167257 Open in IMG/M |
| Source Dataset Name | Passalidae beetle gut microbial communities from Costa Rica -Larvae (3ML+3BL) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 792 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Digestive System → Midgut → Unclassified → Passalidae Beetle Gut → Passalidae Beetle Gut Microbial Communities From Costa Rica |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Quebrada Gonzales Sector, Braulio Carrillo National Park, Costa Rica | |||||||
| Coordinates | Lat. (o) | 10.207151 | Long. (o) | -84.007673 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F096286 | Metagenome | 105 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| IMNBL3_101672572 | F096286 | N/A | ALFDYSVKGKKVDHIRFSQAERSVVYVTVVFADRTEWSISIEPFSLPTARVSHFISIEEDPIAESGQMFLPDHPDSHPQYEEIQQPPKQRKPRKRSKK* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |