Scaffold NODE_c0606719

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold NODE_c0606719

Scaffold NODE_c0606719

Overview

Basic Information
Taxon OID	3300000156 Open in IMG/M
Scaffold ID	NODE_c0606719 Open in IMG/M
Source Dataset Name	Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Ambry Genetics
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1675
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor → Sugar Cane Bagasse Incubating Bioreactor Microbial Communities From Sao Carlos, Brazil, That Are Aerobic And Semianaerobic

Source Dataset Sampling Location
Location Name	Sao Carlos, Brazil
Coordinates	Lat. (^o)	-22.080556	Long. (^o)	-48.997778	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092487	Metagenome / Metatranscriptome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
NODE_06067191	F092487	AGGAGG	MSKVVTVGATTLFACILCATPLSVRFSPEGTVSLSVDSAA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.