NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ElkS_mat_MD6ADRAFT_1000012

Scaffold ElkS_mat_MD6ADRAFT_1000012


Overview

Basic Information
Taxon OID3300000353 Open in IMG/M
Scaffold IDElkS_mat_MD6ADRAFT_1000012 Open in IMG/M
Source Dataset NameHot spring microbial communities from Elkhorn Slough, Monterey Bay, USA - MD6A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)50233
Total Scaffold Genes124 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (10.48%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location NameElkhorn Slough, Monterey Bay, California, USA
CoordinatesLat. (o)36.82188Long. (o)-121.744Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011397Metagenome / Metatranscriptome291Y
F022996Metagenome212Y

Sequences

Protein IDFamilyRBSSequence
ElkS_mat_MD6ADRAFT_100001281F022996N/AMETKIITNIAKMKADIKVKAEEQKFLKNQRKDVNLVGERKMSASDATYKHQCNREELRMMYAAYGLARGKSIKQIENQHDEENHPLKQYQKTIDRIMEGYMKIVEVEPQE*
ElkS_mat_MD6ADRAFT_100001290F011397N/AMKDFELLKRTYPVSQFDRICDGYVYICDNTSVEERKEWRINLKDLQKTIKKGEKYIYQVAKDSGMFKAMCLSFNNYRIIRKHIFGIDDE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.