Basic Information | |
---|---|
Taxon OID | 3300000353 Open in IMG/M |
Scaffold ID | ElkS_mat_MD6ADRAFT_1012526 Open in IMG/M |
Source Dataset Name | Hot spring microbial communities from Elkhorn Slough, Monterey Bay, USA - MD6A |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2098 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Elkhorn Slough, Monterey Bay, California, USA | |||||||
Coordinates | Lat. (o) | 36.82188 | Long. (o) | -121.744 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F036294 | Metagenome / Metatranscriptome | 170 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
ElkS_mat_MD6ADRAFT_10125263 | F036294 | N/A | MDRGSSDEAIVGVKPTADDDAVTYRRGKLLESDKEVGAEGRNM* |
⦗Top⦘ |