NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Draft_104702

Scaffold Draft_104702


Overview

Basic Information
Taxon OID3300000513 Open in IMG/M
Scaffold IDDraft_104702 Open in IMG/M
Source Dataset NameTailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)955
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameFort McMurray in northeastern Alberta, Canada
CoordinatesLat. (o)57.01116Long. (o)-111.6Alt. (m)Depth (m)0 to .1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F041590Metagenome159N

Sequences

Protein IDFamilyRBSSequence
Draft_1047021F041590N/AMNTYLITLTRTKVADVPAPLPMHTRIDTRTRKPESRAFTIDIPTSALPDTSTVPAQFRPLVDSALLDACEQTLNTFVTSKATAGNMQIPVGLFDLEKLLTATAQRRMTAALLIGMWRNSSKYVLEVAPKLTSQTGSALLRYQANIEKHEKRLAALTGKNPELNMSAEDLDKLMVNLTEADSETPYGEYLAQRTEEVRSKLVEDSEAL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.