 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300001049 Open in IMG/M |
| Scaffold ID | JGI11855J13214_100229 Open in IMG/M |
| Source Dataset Name | Marine microbial communities from the Deep Pacific Ocean - MP2159 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4924 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Southwest of Acapulco, Mexico, North Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 12.0 | Long. (o) | -108.06 | Alt. (m) | Depth (m) | 3103.11 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F082562 | Metagenome | 113 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI11855J13214_1002293 | F082562 | N/A | MKTIILGILITLSTNLFAQTNDSLRNYFLDIELSIIHPILGGFGGTIGIERNHSSFGVMGFGTKLNHMMKHYFIEDAEELAVYNWGVELYSDYYIKQNHRGLFIGSLVSINGFRFTDIPNPQTILVLYAVPRVGYRIXLPKKLNAFYFQPSLTAHIKFWDNQEQFLYREIDTKSIFLLSQLTLGMKI* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |