Scaffold JGI11855J13214_105881

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI11855J13214_105881

Scaffold JGI11855J13214_105881

Overview

Basic Information
Taxon OID	3300001049 Open in IMG/M
Scaffold ID	JGI11855J13214_105881 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Deep Pacific Ocean - MP2159
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	738
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location Name	Southwest of Acapulco, Mexico, North Pacific Ocean
Coordinates	Lat. (^o)	12.0	Long. (^o)	-108.06	Alt. (m)		Depth (m)	3103.11
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031535	Metagenome	182	N

Sequences

Protein ID	Family	RBS	Sequence
JGI11855J13214_1058811	F031535	N/A	TDNIIARGPKNTRAYVAIASANQLRGLTNKVNHFQVPFKTSEFSTVNIK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.