Scaffold Lau_10120986

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Lau_10120986

Scaffold Lau_10120986

Overview

Basic Information
Taxon OID	3300001392 Open in IMG/M
Scaffold ID	Lau_10120986 Open in IMG/M
Source Dataset Name	ELSC Metagenome
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4679
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (58.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From The Eastern Lau Spreading Center

Source Dataset Sampling Location
Location Name	Kilo Moana - ELSC (Lau Basin)
Coordinates	Lat. (^o)	-20.0	Long. (^o)	176.0	Alt. (m)		Depth (m)	2600
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087941	Metagenome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Lau_101209868	F087941	N/A	MPEHHEHDDETFVEQVQRLVVDNAFAFVLGWLLGAGHVLSLFSDLAGAFS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.