NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold rank02_1177877

Scaffold rank02_1177877


Overview

Basic Information
Taxon OID3300001477 Open in IMG/M
Scaffold IDrank02_1177877 Open in IMG/M
Source Dataset NameSheep rumen microbial communities from New Zealand - Rank02_low
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)534
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Sheep Rumen → Sheep Rumen Microbial Communities From New Zealand From High And Low Methane Emitting Sheep

Source Dataset Sampling Location
Location NamePalmerston North, New Zealand
CoordinatesLat. (o)-40.352Long. (o)175.608Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032474Metagenome / Metatranscriptome180Y

Sequences

Protein IDFamilyRBSSequence
rank02_11778772F032474N/AMEVQKNIKQCEICKDREAITLCFDCHFYFCEACYKFVHDIKKNSSHKKEKIDLFVPIDTTCPDHGRVPMNLFCIDDKGNIYYNNNIILI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.