NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold shallow_1077063

Scaffold shallow_1077063


Overview

Basic Information
Taxon OID3300001840 Open in IMG/M
Scaffold IDshallow_1077063 Open in IMG/M
Source Dataset NameHydrothermal vent plume microbial communities from the Mid Cayman Rise - Shallow Sites - gte1kb - lt4kb
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1016
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Cayman Rise, Cayman Islands

Source Dataset Sampling Location
Location NameMid Cayman Rise, Cayman Islands
CoordinatesLat. (o)18.35Long. (o)-81.85Alt. (m)Depth (m)2000
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F096028Metagenome105Y

Sequences

Protein IDFamilyRBSSequence
shallow_10770633F096028N/ATISVDFRVDWASFELIDGDFHSHSFGGSVKRNDLMLDEN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.