Scaffold CSTR_1019064

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold CSTR_1019064

Scaffold CSTR_1019064

Overview

Basic Information
Taxon OID	3300002079 Open in IMG/M
Scaffold ID	CSTR_1019064 Open in IMG/M
Source Dataset Name	CSTRmetagenomics
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6454
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (12.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater Treatment Plant → Wastewater Treatment Plant Microbial Communities From Luxembourg

Source Dataset Sampling Location
Location Name	Belvaux, Luxembourg
Coordinates	Lat. (^o)	49.507864	Long. (^o)	5.943557	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030486	Metagenome / Metatranscriptome	185	Y

Sequences

Protein ID	Family	RBS	Sequence
CSTR_10190648	F030486	N/A	RYVALAQSRGGACFCTRGAVQDYAVITLFSRWQKP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.