NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold CSTR_1022109

Scaffold CSTR_1022109


Overview

Basic Information
Taxon OID3300002079 Open in IMG/M
Scaffold IDCSTR_1022109 Open in IMG/M
Source Dataset NameCSTRmetagenomics
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2470
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater Treatment Plant → Wastewater Treatment Plant Microbial Communities From Luxembourg

Source Dataset Sampling Location
Location NameBelvaux, Luxembourg
CoordinatesLat. (o)49.507864Long. (o)5.943557Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023356Metagenome / Metatranscriptome210Y
F048287Metagenome / Metatranscriptome148N

Sequences

Protein IDFamilyRBSSequence
CSTR_10221092F023356AGGAGMSENSLKKAVLESRVSAAEAEVMSTELEKSKVITLRVEEPLFKAIEAQAELWNVKPAETIRRVLRFYFLPVALELELRGESEKFWKGEFTPEAVGEYMVFLLETTEKIRSSALFLSREAVKLSEATEGKLSEALEEEREGAET*
CSTR_10221093F048287AGGAMYNKAVLLQTLQQVRLKVIDTLKLMLSDYEVSPESSLRVQPASYEVATGEKVEYPLFRNEAGTFYGSKAYLNTENWNLTLKPLPAGTRGVGAFLQFSVPKNYYGSNYFSVGEAGTRAALKKVEGELVQNGVFTNLEEAELSRVDTFKNIEPEEPFSSYFSLFSLLKARRAQQRGYGTTFLVSNSSQEFCVYDKLQEMREHGLETSELPETMRFEHRALKKEKVRSLYGFTSVSELFHGGYEVVKEKQVESWKNSLFSFSAEEVVVLGSKQLEQEMKVFQERFGSNWFQYFLRSYGAYSLAKFAGKEVVRAALENLNSERTKVWRTMKLLEEAERELLVLKQEEGSSKTLGELYEELRGKVCELAGRN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.