Scaffold CSTR_1028770

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold CSTR_1028770

Scaffold CSTR_1028770

Overview

Basic Information
Taxon OID	3300002079 Open in IMG/M
Scaffold ID	CSTR_1028770 Open in IMG/M
Source Dataset Name	CSTRmetagenomics
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1270
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater Treatment Plant → Wastewater Treatment Plant Microbial Communities From Luxembourg

Source Dataset Sampling Location
Location Name	Belvaux, Luxembourg
Coordinates	Lat. (^o)	49.507864	Long. (^o)	5.943557	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047964	Metagenome / Metatranscriptome	149	N

Sequences

Protein ID	Family	RBS	Sequence
CSTR_10287702	F047964	GGAGG	MVSKKEMLVILNKVAAVFGKEIDEKLVSVYHLALKQYSRMALADAAMLCVQENSFMPRPKDLVEKIDKYDLERKWQVVEPSTERTYWVLFREEYETTDDINEIECKEIFADEYVGAPKLKKTSETNNMSDEERLIQFRKLY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.