NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGIcombinedJ26738_114637

Scaffold JGIcombinedJ26738_114637


Overview

Basic Information
Taxon OID3300002169 Open in IMG/M
Scaffold IDJGIcombinedJ26738_114637 Open in IMG/M
Source Dataset Namefloor swab of Spacecraft Assembly Facility - replicate A (Combined floor swab M2426|M2425|M2424|M2423|M2428|M2427, ASSEMBLY_DATE=20140108)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)549
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Unclassified → Unclassified → Unclassified → Unclassified → Clean Room → Clean Room Microbial Communities From Nasa Spacecraft Assembly Facility At Jet Propulsion Laboratory, Pasadena, California, Usa

Source Dataset Sampling Location
Location NameNASA Jet Propulsion Laboratory, Pasadena, California, USA
CoordinatesLat. (o)34.1991Long. (o)-118.1715Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033665Metagenome / Metatranscriptome176Y

Sequences

Protein IDFamilyRBSSequence
JGIcombinedJ26738_1146372F033665N/AMLICGSIGCALAIKIGGEAKTHEISKTQKWSGQILLGLEDIKIINIFNGVPKSKRRKNKILMGINIKLG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.