Scaffold DRAFT_10675878

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold DRAFT_10675878

Scaffold DRAFT_10675878

Overview

Basic Information
Taxon OID	3300002597 Open in IMG/M
Scaffold ID	DRAFT_10675878 Open in IMG/M
Source Dataset Name	Camel rumen microbial communities from Jandagh-Isfahan, Iran - Sample 1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1267
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Camel Rumen → Camel Rumen Microbial Communities From Jandagh-Isfahan, Iran

Source Dataset Sampling Location
Location Name	Jandaq, Isfahan Province, Iran
Coordinates	Lat. (^o)	34.041281	Long. (^o)	54.414582	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059440	Metagenome / Metatranscriptome	134	Y

Sequences

Protein ID	Family	RBS	Sequence
DRAFT_106758782	F059440	N/A	MEQKSRKEREAEFKAKIAKLDAYVEEMNAKGNLTDEEWKEVWSAMLQTNKYLRAIGAPESEMYDI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.