Scaffold draft_1442058

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold draft_1442058

Scaffold draft_1442058

Overview

Basic Information
Taxon OID	3300002700 Open in IMG/M
Scaffold ID	draft_1442058 Open in IMG/M
Source Dataset Name	Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Biofilm from sections of failed pipe - PAS_821
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	McGill University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6821
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (87.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location Name	Fort McMurray, Alberta, Canda
Coordinates	Lat. (^o)	55.07	Long. (^o)	-110.53	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054974	Metagenome	139	Y

Sequences

Protein ID	Family	RBS	Sequence
draft_14420582	F054974	GGAGG	MKRSQLNKSRFIVGIILVVIAVLMFLFVKEDYSTAGAIGIGILGLVSIAISRRK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.