Scaffold Iso3TCLC_10027731

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Iso3TCLC_10027731

Scaffold Iso3TCLC_10027731

Overview

Basic Information
Taxon OID	3300002821 Open in IMG/M
Scaffold ID	Iso3TCLC_10027731 Open in IMG/M
Source Dataset Name	Iso-alkanes.Hi.seq-Iso3T
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	McGill University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	17268
Total Scaffold Genes	27 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	19 (70.37%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location Name	Athabasca Oil Sands, Alberta Canada
Coordinates	Lat. (^o)	57.02	Long. (^o)	-111.65	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047754	Metagenome / Metatranscriptome	149	Y

Sequences

Protein ID	Family	RBS	Sequence
Iso3TCLC_1002773117	F047754	GGAGG	MKRILCLIVAIACLFVLSSCSLIGIDNPTSTPATVAPNYPQSVVYKIELSQETYLCSSFNISNTDTEISLQLSEVYSVSSDGKITWMGQQKEISAVKIEKISK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.