Scaffold contig_10320

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold contig_10320

Scaffold contig_10320

Overview

Basic Information
Taxon OID	3300002843 Open in IMG/M
Scaffold ID	contig_10320 Open in IMG/M
Source Dataset Name	Stormwater retention pond microbial communities from Williamsburg, VA - Sample from Greensprings
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	800
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Pond → Unclassified → Stormwater Retention Pond → Stormwater Retention Pond Microbial Communities From Williamsburg, Va

Source Dataset Sampling Location
Location Name	Jamestown, Virginia, United States
Coordinates	Lat. (^o)	37.248966	Long. (^o)	-76.787831	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091218	Metagenome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
contig_103202	F091218	N/A	MPETAKIVDSFRTVFPKIKVLYAEEGPYRVGKKPDPSKYVVPNIGYLSDKPTEKKGRKK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.