Scaffold Ga0005259J43196_1008218

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0005259J43196_1008218

Scaffold Ga0005259J43196_1008218

Overview

Basic Information
Taxon OID	3300002878 Open in IMG/M
Scaffold ID	Ga0005259J43196_1008218 Open in IMG/M
Source Dataset Name	Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - MetaT SI074_150m_A (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1378
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → Methylotenera → Methylotenera mobilis	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Source Dataset Sampling Location
Location Name	British Columbia, Canada
Coordinates	Lat. (^o)	48.7299	Long. (^o)	-123.5699	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075397	Metagenome / Metatranscriptome	119	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0005259J43196_10082182	F075397	AGAAG	MKYWHKRVDVVSFFDLDQENQDIELKDDDNADEFAFLIAENGEYWNLDLFMRTESGRYDGVMGLTNTSAIGIVLSCSGESAVIQCFS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.