Basic Information | |
---|---|
Taxon OID | 3300002931 Open in IMG/M |
Scaffold ID | CVPL010W_10058149 Open in IMG/M |
Source Dataset Name | Ant worker gut metagenome for colony PL010 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Harvard University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 823 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Cephalotes Varians → Cephalotes Varians Microbial Communities From The Florida Keys, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: North Key Largo, Florida | |||||||
Coordinates | Lat. (o) | 25.2845833 | Long. (o) | -80.3122167 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F059647 | Metagenome | 133 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
CVPL010W_100581492 | F059647 | N/A | MLYNMASTGPVCPVVGNVGLLRSRISSLNELVHFKAELRDPGLVYQVVACTAL* |
⦗Top⦘ |